Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184258

Catenin beta-1 (CTNB1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Bfc, Catnb, Mesc, ctnnb, id:ibd2058, wu:fb73e10, wu:fi81c06, wu:fk25h01, CHBCAT
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Pig (Porcine), Cow (Bovine), Human, Zebrafish (Danio rerio), Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN184258
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CTNNB1 antibody: synthetic peptide directed towards the C terminal of human CTNNB1
Sequence DPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDS NQLAWFDTDL
Predicted Reactivity African clawed frog : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against CTNNB1. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name CTNNB1
Background CTNNB1 is involved in the regulation of cell adhesion and in signal transduction through the Wnt pathway.
Molecular Weight 76kDa
Gene ID 1499
NCBI Accession XP_001133664
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CTNNB1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Onilude, Lusher, Lindsey et al.: "APC and CTNNB1 mutations are rare in sporadic ependymomas." in: Cancer genetics and cytogenetics, Vol. 168, Issue 2, pp. 158-61, 2006 (PubMed).

Alternatives for antigen "Catenin beta-1 (CTNB1)", type "Antibodies"
Hosts (461), (148), (2), (1)
Reactivities (573), (323), (304), (191), (160), (116), (13), (7), (6), (5), (4), (4), (3), (2), (2), (1), (1), (1), (1), (1), (1)
Applications (446), (173), (151), (140), (117), (96), (70), (55), (40), (22), (8), (5), (3), (1), (1), (1), (1)
Conjugates (19), (16), (16), (15), (14), (14), (14), (14), (14), (14), (14), (1), (1)
Epitopes (55), (53), (48), (43), (43), (28), (20), (16), (15), (15), (13), (12), (9), (7), (7), (5), (5), (5), (4), (4), (4), (4), (4), (4), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Beacon