Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184263

Matrix Metalloproteinase 2 (MMP2) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
CLG4, MONA, CLG4A, TBE-1, MMP-II, GelA, Clg4a, MMP-2, 2-MMP, CG1794, DM2-MMP, Dm2-MMP, Dmel\\CG1794, MMP2, anon-WO0118547.84, dm-2MMP, dmmp2, l(2)02353, mmp2, wu:fa99h12, wu:fk89d01, fgmmp-2, Mmp-2, L ... show more
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Pig (Porcine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN184263
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MMP2 antibody: synthetic peptide directed towards the C terminal of human MMP2
Sequence AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSV KFGSIKSDWL
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Sheep : 100%, Rabbit : 93%
Characteristics This is a rabbit polyclonal antibody against MMP2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name MMP2
Background MMP-2 is involved in the cleavage of gelatin type I and collagen types IV, V, VII, X.
Molecular Weight 74kDa
Gene ID 4313
NCBI Accession NP_004521, NM_004530
UniProt P08253
Research Area Cancer, Proteolysis / Ubiquitin, Metalloprotease, Angiogenesis, Matrix Metalloproteinases, Extracellular Matrix
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MMP2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Collier, Wilhelm, Eisen et al.: "H-ras oncogene-transformed human bronchial epithelial cells (TBE-1) secrete a single metalloprotease capable of degrading basement membrane collagen." in: The Journal of biological chemistry, Vol. 263, Issue 14, pp. 6579-87, 1988 (PubMed).

Alternatives for antigen "Matrix Metalloproteinase 2 (MMP2)", type "Antibodies"
Hosts (145), (102), (5), (2), (1)
Reactivities (233), (103), (93), (42), (37), (25), (12), (1), (1), (1), (1)
Applications (196), (102), (100), (59), (38), (35), (30), (27), (21), (17), (10), (6), (2), (1), (1), (1), (1), (1)
Conjugates (19), (12), (6), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (1), (1)
Epitopes (12), (11), (8), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Beacon