Matrix Metalloproteinase 2 (MMP2) (C-Term) antibody

Details for Product No. ABIN184263
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
CLG4, MONA, CLG4A, TBE-1, MMP-II, GelA, Clg4a, MMP-2, 2-MMP, CG1794, DM2-MMP, Dm2-MMP, Dmel\\CG1794, MMP2, anon-WO0118547.84, dm-2MMP, dmmp2, l(2)02353, mmp2, wu:fa99h12, wu:fk89d01, fgmmp-2, Mmp-2, L ... show more
CLG4, MONA, CLG4A, TBE-1, MMP-II, GelA, Clg4a, MMP-2, 2-MMP, CG1794, DM2-MMP, Dm2-MMP, Dmel\\CG1794, MMP2, anon-WO0118547.84, dm-2MMP, dmmp2, l(2)02353, mmp2, wu:fa99h12, wu:fk89d01, fgmmp-2, Mmp-2, LOC100135793 show less
Epitope
C-Term
(14), (9), (8), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Pig (Porcine), Human
(224), (102), (91), (42), (40), (20), (12), (3), (2), (2), (1), (1), (1)
Host
Rabbit
(150), (94), (3), (2), (1), (1), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(17), (9), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(190), (102), (92), (51), (41), (32), (30), (29), (24), (22), (4), (1), (1), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN184263
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human MMP2
Sequence AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSV KFGSIKSDWL
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Sheep : 100 %, Rabbit : 90 %
Characteristics This is a rabbit polyclonal antibody against MMP2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name MMP2
Background MMP-2 is involved in the cleavage of gelatin type I and collagen types IV, V, VII, X.
Molecular Weight 74 kDa
Gene ID 4313
NCBI Accession NM_004530, NP_004521
UniProt P08253
Research Area Cancer, Proteolysis / Ubiquitin, Metalloprotease, Angiogenesis, Matrix Metalloproteinases, Extracellular Matrix
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 660 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Matrix Metalloproteinase 2 (MMP2) (C-Term) antibody anti-Matrix Metalloproteinase 2 (MMP2) (C-Term) antibody
anti-Matrix Metalloproteinase 2 (MMP2) (C-Term) antibody (2) anti-Matrix Metalloproteinase 2 (MMP2) (C-Term) antibody (Image 2)
Background publications Collier, Wilhelm, Eisen et al.: "H-ras oncogene-transformed human bronchial epithelial cells (TBE-1) secrete a single metalloprotease capable of degrading basement membrane collagen." in: The Journal of biological chemistry, Vol. 263, Issue 14, pp. 6579-87, 1988 (PubMed).

Hosts (150), (94), (3), (2), (1), (1), (1)
Reactivities (224), (102), (91), (42), (40), (20), (12), (3), (2), (2), (1), (1), (1)
Applications (190), (102), (92), (51), (41), (32), (30), (29), (24), (22), (4), (1), (1), (1), (1), (1)
Conjugates (17), (9), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (1), (1)
Epitopes (14), (9), (8), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top