Did you know that you can buy products from over 140 different suppliers from us?

Early Growth Response 2 (EGR2) (C-Term) antibody

Details for Product No. ABIN184325
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AT591, CMT1D, CMT4E, KROX20, Egr-2, Zfp-6, Krox20, NGF1-B, Zfp-25, Krox-20
Epitope
C-Term
(10), (8), (5), (5), (4), (4), (1), (1), (1), (1)
Reactivity
Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Zebrafish
(54), (30), (25), (7), (4)
Host
Rabbit
(45), (9), (8)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(52), (25), (10), (10), (6), (5), (4), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN184325
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human EGR2
Sequence PFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVP APSTASCSGG
Cross-Reactivity Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Predicted Reactivity Bovine : 100 %, Human : 100 %, Mouse : 100 %, Dog : 90 %, Pig : 90 %, Rabbit : 90 %, Rat : 90 %, Horse : 80 %
Purification Affinity Purified
Alternative Name EGR2
Background The early growth response protein 2 (EGR2) is a transcription factor with three tandem C2H2-type zinc fingers. Mutations in this gene are associated with the autosomal dominant Charcot-Marie-Tooth disease, type 1.The early growth response protein 2 is a transcription factor with three tandem C2H2-type zinc fingers. Mutations in this gene are associated with the autosomal dominant Charcot-Marie-Tooth disease, type 1.
Molecular Weight 50 kDa
NCBI Accession NM_000399, NP_000390
UniProt P11161
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes WB Suggested Anti-EGR2 Antibody Titration: 0.2-1 µg/mL
ELISA Titer: 1:312500
Positive Control: Human Lung.
Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 476 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4 °C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -24 °C
Supplier Images
anti-Early Growth Response 2 (EGR2) (C-Term) antibody WB Suggested Anti-EGR2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Lung
anti-Early Growth Response 2 (EGR2) (C-Term) antibody (2) anti-Early Growth Response 2 (EGR2) (C-Term) antibody (Image 2)
Background publications Yoo, Lee: "Hepatitis B virus X protein induces expression of Fas ligand gene through enhancing transcriptional activity of early growth response factor." in: The Journal of biological chemistry, Vol. 279, Issue 35, pp. 36242-9, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN184325
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top