Did you know that you can buy products from over 140 different suppliers from us?

Transcription Factor 7 (T-Cell Specific, HMG-Box) (TCF7) (C-Term) antibody

Details for Product No. ABIN184328
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TCF-1, AI465550, Tcf1
Epitope
C-Term
(13), (4), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Dog (Canine), Human, Mouse (Murine)
(45), (11), (3), (2), (2)
Host
Rabbit
(35), (8), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(43), (21), (5), (4), (3), (3), (2), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN184328
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human TCF7
Sequence YLPGEGRCPSPVPSDDSALGCPGSPAPQDSPSYHLLPRFP TELLTSPAER
Cross-Reactivity Dog (Canine), Human, Mouse (Murine)
Predicted Reactivity Human : 100 %, Dog : 90 %, Mouse : 80 %, Rat : 80 %
Purification Affinity Purified
Alternative Name TCF7 / TCF1
Background The T-cell-specific transcription factor TCF7 activates genes involved in immune regulation and is a candidate locus for genetic susceptibility to type 1 diabetes.
Molecular Weight 54 kDa
UniProt P36402-3
Research Area Stem Cells, Wnt, Transcription Factors
Application Notes WB Suggested Anti-TCF7 Antibody Titration: 0.2-1 µg/mL
Positive Control: Jurkat cell lysate.
Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 494 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4 °C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -24 °C
Supplier Images
anti-Transcription Factor 7 (T-Cell Specific, HMG-Box) (TCF7) (C-Term) antibody WB Suggested Anti-TCF7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
anti-Transcription Factor 7 (T-Cell Specific, HMG-Box) (TCF7) (C-Term) antibody (2) WB Suggested Anti-TCF7
Antibody Titration: 0.2-1 µg/mL
Positive Control: Jurkat cell lysate
TCF7 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
Background publications Roose, Huls, van Beest et al.: "Synergy between tumor suppressor APC and the beta-catenin-Tcf4 target Tcf1." in: Science (New York, N.Y.), Vol. 285, Issue 5435, pp. 1923-6, 1999 (PubMed).

Validation Images
back to top