General Transcription Factor IIE, Polypeptide 1, alpha 56kDa (GTF2E1) (C-Term) antibody

Details for Product No. ABIN184330
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms
FE, 56kDa, TFIIE-A, AI303800, 2610024P03Rik, TF2E1, GTF2E2, DDBDRAFT_0168201, DDBDRAFT_0168202, DDBDRAFT_0231096, DDB_0168201, DDB_0168202, DDB_0231096, DDBDRAFT_0217176, DDBDRAFT_0217177, DDBDRAFT_02 ... show more
FE, 56kDa, TFIIE-A, AI303800, 2610024P03Rik, TF2E1, GTF2E2, DDBDRAFT_0168201, DDBDRAFT_0168202, DDBDRAFT_0231096, DDB_0168201, DDB_0168202, DDB_0231096, DDBDRAFT_0217176, DDBDRAFT_0217177, DDBDRAFT_0266401, DDB_0217176, DDB_0217177, DDB_0266401, DDBDRAFT_0187408, DDBDRAFT_0266450, DDB_0187408, DDB_0266450 show less
Epitope
C-Term
(4), (4), (2), (2), (1), (1)
Reactivity
Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Fruit Fly (Drosophila melanogaster)
(19), (1), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(10), (9)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(15), (4), (4), (3), (2), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN184330
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human GTF2E1
Sequence VADDPIVMVAGRPFSYSEVSQRPELVAQMTPEEKEAYIAM GQRMFEDLFE
Cross-Reactivity Cow (Bovine), Dog (Canine), Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 90 %, African clawed frog : 80 %
Characteristics Antigen Size: 439 amino acids
Purification Affinity Purified
Alternative Name GTF2E1 / TF2E1
Background The general transcription factor TFIIE has an essential role in eukaryotic transcription initiation together with RNA polymerase II and other general factors. Human TFIIE consists of two subunits of relative molecular mass 57,000 (TFIIE-alpha) and 34,000 (TFIIE-beta) and joins the preinitiation complex after RNA polymerase II and TFIIF. TFIIE-alpha is necessary for transcription initiation together with TFIIE-beta, and recombinant TFIIE-alpha can fully replace the natural subunit in an in vitro transcription assay. Its sequence contains several interesting structural motifs (leucine repeat, zinc finger and helix-turn-helix) and sequence similarities to bacterial sigma factors that suggest direct involvement in the regulation of transcription initiation
Molecular Weight 49 kDa
NCBI Accession NM_005513, NP_005504
UniProt P29083
Application Notes WB Suggested Anti-GTF2 E1 Antibody Titration: 0.2-1 µg/mL
Positive Control: Daudi cell lysate.
Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 439 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4 °C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -24 °C
Supplier Images
anti-General Transcription Factor IIE, Polypeptide 1, alpha 56kDa (GTF2E1) (C-Term) antibody WB Suggested Anti-GTF2E1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Daudi cell lysate
anti-General Transcription Factor IIE, Polypeptide 1, alpha 56kDa (GTF2E1) (C-Term) antibody (2) anti-General Transcription Factor IIE, Polypeptide 1, alpha 56kDa (GTF2E1) (C-Term) antibody (Image 2)
Background publications Ohkuma, Sumimoto, Hoffmann et al.: "Structural motifs and potential sigma homologies in the large subunit of human general transcription factor TFIIE." in: Nature, Vol. 354, Issue 6352, pp. 398-401, 1992 (PubMed).

Hosts (10), (9)
Reactivities (19), (1), (1), (1), (1), (1), (1), (1)
Applications (15), (4), (4), (3), (2), (2), (2), (1)
Epitopes (4), (4), (2), (2), (1), (1)
back to top