Cold Shock Domain Protein A (CSDA) (C-Term) antibody

Details for Product No. ABIN184338
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CSDA, CSDA1, DBPA, ZONAB, Csda, Dpba, MSY3, MSY4, Yb2, dbpA, oxyR, Dbpa, contrin, csda, csda-A, csda3, dbpc, frgy2, msy2, p54
Epitope
C-Term
(4), (3), (3), (2), (2), (2), (1), (1)
Reactivity
Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)
(35), (16), (13), (13), (13), (12), (3)
Host
Rabbit
(30), (8)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(29), (10), (9), (4), (4), (2), (2), (2)
Pubmed 2 references available
Catalog no. ABIN184338
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human CSDA
Sequence GPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYN YRRRPRPPNA
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Guinea pig : 90 %, Mouse : 90 %, Rat : 90 %  
Characteristics Antigen Size: 372 amino acids
Purification Protein A purified
Alternative Name DNA-binding protein A
Background Human DNA-binding protein (dbpA) is a member of a Y-box binding protein family containing a cold shock domain. The increased expression of Y box binding proteins in somatic cells is associated with cell proliferation and transformation.
Molecular Weight 40 kDa
NCBI Accession NM_003651, NP_003642
UniProt P16989
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 372 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4 °C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -24 °C
Background publications Hayashi, Kajino, Umeda et al.: "Somatic mutation and SNP in the promoter of dbpA and human hepatocarcinogenesis." in: International journal of oncology, Vol. 21, Issue 4, pp. 847-50, 2002 (PubMed).

General Chiu, Witkowska, Hall et al.: "High-molecular-mass APOBEC3G complexes restrict Alu retrotransposition." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 42, pp. 15588-93, 2006 (PubMed).

Hosts (30), (8)
Reactivities (35), (16), (13), (13), (13), (12), (3)
Applications (29), (10), (9), (4), (4), (2), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (3), (2), (2), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top