Homeobox C6 (HOXC6) (C-Term) antibody

Details for Product No. ABIN184343
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms CP25, HOX3, HOX3C, HHO.C8, Hox-3.3, Hox-6.1, Hoxc-6, xlhbox1, ZF-61, hoxc6, HOX-C6, hoxc-6, zgc:101882, HOXC6
Epitope
C-Term
(10), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Chicken
(38), (24), (14), (12)
Host
Rabbit
(36), (2), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(29), (18), (10), (3), (3), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN184343
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human HOXC6
Sequence KIWFQNRRMKWKKESNLTSTLSGGGGGATADSLGGKEEKR EETEEEKQKE
Cross-Reactivity Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Rabbit : 90 %
Characteristics Antigen Size: 235 amino acids
Purification Affinity Purified
Alternative Name HOXC6 / HOX3C
Background HOXC6 belongs to the homeobox family, members of which encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC6, is one of several HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Alternatively spliced transcript variants encoding different isoforms have been identified for HOXC6. Transcript variant two includes the shared exon, and transcript variant one includes only gene-specific exons.This gene belongs to the homeobox family, members of which encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC6, is one of several HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Alternatively spliced transcript variants encoding different isoforms have been identified for HOXC6. Transcript variant two includes the shared exon, and transcript variant one includes only gene-specific exons.
Molecular Weight 27 kDa
NCBI Accession NM_004503, NP_004494
Application Notes WB Suggested Anti-HOXC6 Antibody Titration: 0.2-1 µg/mL
ELISA Titer: 1:62500
Positive Control: DU145 cell lysate.
Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 235 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4 °C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -24 °C
Supplier Images
anti-Homeobox C6 (HOXC6) (C-Term) antibody WB Suggested Anti-HOXC6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: DU145 cell lysate
Background publications Ramachandran, Liu, Young et al.: "Loss of HOXC6 expression induces apoptosis in prostate cancer cells." in: Oncogene, Vol. 24, Issue 1, pp. 188-98, 2005 (PubMed).

Hosts (36), (2), (1)
Reactivities (38), (24), (14), (12)
Applications (29), (18), (10), (3), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (10), (2), (2), (1), (1), (1), (1), (1)
back to top