Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Parathyroid Hormone-Like Hormone (PTHLH) (AA 53-86) antibody

Antigen

Parathyroid Hormone-Like Hormone (PTHLH)

Synonyms HHM, PLP, PTHR, PTHRP, MGC14611, PTHrP, PTHLH, pthrp
Epitope
Alternatives

AA 53-86

Clonality Polyclonal
Host
Reactivity
Alternatives

Human

Application
Alternatives Radioimmunoassay (RIA)
Catalog no. ABIN191655
Quantity 20 µl
Price 215.00 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 7 to 10 Business Days

Additional Information

Characteristics Synonyms: PTH-rP, Parathyroid hormone related protein, PTHLH, PLP, Parathyroid hormone-like protein
Alternative name PTHRP
Swiss-Prot P12272
Immunogen Synthetic human PTHrP (aa 53-86) KLH-conjugatedAA Sequence: KNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTP
Cross-Reactivity Human
Specificity This antibody detects PTHrP (aa 53-86, 1-86). Species: Human. Others not tested. Add. Information: Reference no. : LocusID 5744

Application Details

Application Notes RIA (1: 2000). Other applications not tested. Optimal dilutions are dependent on conditions and should be determined by the user.
Purification Serum
Storage Store lyophilized at 2 - 8 °C and reconstituted at -20 °C. Avoid repeated freezing andthawing. Shelf life: One year from despatch.
Restrictions For Research Use only

Alternatives

Alternatives for antigen "Parathyroid Hormone-Like Hormone (PTHLH)", type "Antibodies"
Hosts Rabbit (10), Mouse (7), Goat (4)
Reactivities Human (19), Mouse (Murine) (3), Rat (Rattus) (2)
Applications Western Blotting (WB) (12), ELISA (6), Enzyme Immunoassay (EIA) (6), Radioimmunoassay (RIA) (6), Immunofluorescence (IF) (4), Immunohistochemistry (IHC) (4), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Blocking Antibody (Inhibition) (1), ELISA (Detection) (1)
Epitopes AA 1-30 (2), AA 1-34 (2), AA 53-86 (2), N-Term (2), Center (1), amino acids 107-111 (1)