Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Parathyroid Hormone (PTH) (AA 1-34) antibody

Antigen

Parathyroid Hormone (PTH)

Synonyms PTH1, Pthp, MGC117651, Pth1, Pthr1, PTH-(1-84), PTH
Epitope
Alternatives

AA 1-34

Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human

Application
Alternatives Enzyme Immunoassay (EIA)
Catalog no. ABIN191669
Quantity 20 µl
Price 215.00 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 7 to 10 Business Days

Additional Information

Characteristics Synonyms: Parathormone, Parathyrin
Alternative name Parathyroid hormone / PTH
Swiss-Prot P01270
Immunogen Synthetic human PTH (aa 1-34) bTG- conjugated. AA Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Cross-Reactivity Human
Description Parathyroid hormone is secreted by parathyroid cells. This hormone elevates blood Ca2+levels by dissolving the salts in bone and preventing their renal excretion. Defects in thisgene are a cause of familial isolated hypoparathyroidism (FIH). Most PTH is secreted in itsintact, mature 9. 5 kDa form, amino acids 1-84, however, it can also be secreted asN-terminal truncated fragments or C-terminal fragments after intracellular degradation, asin case of hypercalcemia. No PTH fragment has been found to be the result of another geneor alternative splicing of the PTH gene.
Specificity This antibody detects PTH (aa 15-25, 1-34, 1-38, 1-84, 7-84). There were no Cross reactivity obtained with synthetic human peptide (aa 1-10). Species: Human. Others not tested. Add. Information: LocusID 5741

Application Details

Application Notes ELISA (1/3,000). Other applications not tested. Optimal dilutions are dependent on conditions and should be determined by the user.
Purification Serum
Storage Store lyophilized at 2-8°C and reconstituted at -20°C. Avoid repeated freezing and thawing. Shelf life: One year from despatch.
Restrictions For Research Use only

Alternatives

Alternatives for antigen "Parathyroid Hormone (PTH)", type "Antibodies"
Hosts Mouse (64), Rabbit (27), Goat (6), Rat (2), Sheep (2)
Reactivities Human (89), Rat (Rattus) (2)
Applications Enzyme Immunoassay (EIA) (54), Radioimmunoassay (RIA) (35), ELISA (27), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (17), Immunohistochemistry (Frozen Sections) (IHC (fro)) (15), Western Blotting (WB) (14), Immunohistochemistry (IHC) (6), Dot Blot (Dot) (2), ELISA (Detection) (1)
Conjugates Biotin (2)
Epitopes AA 1-38 (18), AA 1-34 (13), AA 1-10 (10), AA 32-155 (9), AA 44-68 (4), AA 28-48 (2), N-Term AA 1-34 (2), AA 32-116 (1), Amino Acids 15-25 (1), amino acids 53-68 (1), amino acids 53-84 (1)