Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Calcitonin-Related Polypeptide alpha (CALCA) antibody

Antigen

Calcitonin-Related Polypeptide alpha (CALCA)
Synonyms CALCA, CALC3, MGC152154, CT, KC, CGRP, CALC1, CGRP1, CGRP-I, MGC126648, CFP1, CGBP, SPP1, PCCX1, PHF18, hCGBP, HsT2645, 2410002I16Rik, 5830420C16Rik, CALC, calcitonin, calca, ci-ct
Clonality Polyclonal
Host
Reactivity
Alternatives

Human
Application
Alternatives Radioimmunoassay (RIA)
Catalog no. ABIN191802
Quantity 20 µl  (Variants)
Price 215.00 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 7 to 10 Business Days

Additional Information
Application Details Alternatives Secondary Antibodies Variants back to top

Characteristics Synonyms: Calcitonin gene-related peptide I, Alpha-type CGRP, CALC1, CGRP-I
Alternative name CGRP / CALCA
Swiss-Prot P06881
Immunogen AA Sequence: ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF
Cross-Reactivity Human
Description CGRP is present in C-cells of the thyroid and in central and peripheral nerves. CGRP hasseveral important physiologic roles: it is a potent vasodilator, and can affect the force andrate of heart beat, it can modulate acetylcholine receptor function at the neuromuscularjunction, it has been demonstrated to block tolerance to morphine, and it can modulateantigen presentation in Langerhans cells in the skin. Despite these important physiologicfunctions, therapeutic strategies using CGRP have been impeded due to the lack of acloned CGRP receptor with which ligands could be developed.
Specificity This antibody detects Calcitonin Gene-related Peptide. There were no cross reactivities obtained with human and salmon Katacalcin andCalcitonin. Species: Human. Others not tested. Add. Information: LocusID 797

Application Details
Alternatives Secondary Antibodies Variants back to top

Application Notes RIA (1: 3,000). Other applications not tested. Optimal dilutions are dependent on conditions and should be determined by the user.
Purification Serum
Storage Store lyophilized at 2 - 8 °C and reconstituted at -20 °C. Avoid repeated freezing andthawing. Shelf life: One year from despatch.
Research Area Hormones, Neurotransmitters
Restrictions For Research Use only

Alternatives
Application Details Secondary Antibodies Variants back to top

Alternatives for antigen "Calcitonin-Related Polypeptide alpha (CALCA)", type "Antibodies"
Hosts Rabbit (93), Mouse (24), Goat (6), Sheep (5), Chicken (2), Guinea Pig (2)
Reactivities Human (117), Rat (Rattus) (36), Dog (Canine) (27), Mouse (Murine) (20), Pig (Porcine) (10), Sheep (Ovine) (10), Monkey (7), Rabbit (7), Hamster (6), Cow (Bovine) (3), Mammalian (3), Horse (Equine) (2), Chicken (1), Guinea Pig (1), Reptile (1), Zebrafish (Danio rerio) (1)
Applications Immunofluorescence (IF) (47), Flow Cytometry (FACS) (36), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (36), Enzyme Immunoassay (EIA) (27), Western Blotting (WB) (25), Immunohistochemistry (Frozen Sections) (IHC (fro)) (22), Radioimmunoassay (RIA) (20), ELISA (13), Immunohistochemistry (IHC) (10), Immunoprecipitation (IP) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (4), Electrophoresis (EP) (3), ELISA (Capture) (2), ELISA (Detection) (2), Immunoelectron Microscopy (IEM) (2)
Conjugates Biotin (6), Alexa Flour 488 (2), Alexa Fluor 350 (2), Alexa Fluor 488 (2), Alexa Fluor 555 (2), Alexa Fluor 647 (2), Cy3 (2), Cy5 (2), Cy5.5 (2), Cy7 (2), FITC (2), Gold (2), HRP (2), PE (2), PE,Cy3 (2), PE,Cy5 (2), PE,Cy5.5 (2), PE,Cy7 (2), RBITC (2)
Epitopes AA 1-32 (6), C-Term (2)