beta Defensin 1 antibody (N-Term)

Catalog No. ABIN192005

Product Details anti-beta Defensin 1 Antibody

Target: beta Defensin 1 (DEFB1) (Defensin, beta 1 (DEFB1))

Binding Specificity: AA 1-36, N-Term

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This beta Defensin 1 antibody is un-conjugated

Application: Western Blotting (WB), Enzyme Immunoassay (EIA)

Specificity: This antibody detects Beta-Defensin 1 (aa 1-36). No cross reactivity obtainded with Human Beta-Defensin 3, Beta-Defensin 4, Beta-Defensin 12 and Beta-Defensin 16.

Characteristics: Synonyms: Beta-defensin 1, BD1, BD-1, HBD1, hBD-1, DEFB1, DEFB101

Purification: Protein G Chromatography

Immunogen: Synthetic human β-Defensin 1 (aa 1-36) (3 disulfide bridges)AA Sequence: DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

Clone: M4-14b-H4 (M11-14b-H4)

Isotype: IgG1

Application Details

Application Notes: ELISA. Western blot.
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user.

Restrictions: For Research Use only

Handling

Reconstitution: Restore in aqua bidest to 1 mg/mL.

Buffer: PBS, pH 7.4

Storage: 4 °C/-20 °C

Storage Comment: Store lyophilized at 2 - 8 °C and reconstituted at -20 °C. Avoid repeated freezing and thawing.
Shelf life: One year from despatch.

Expiry Date: 12 months

Target Details for beta Defensin 1

Target: beta Defensin 1 (DEFB1) (Defensin, beta 1 (DEFB1))

Alternative Name: Defensin beta 1 (DEFB1 Products)

Synonyms: BD1 antibody, DEFB-1 antibody, DEFB101 antibody, HBD1 antibody, AW260221 antibody, BD-1 antibody, DEFB1-like antibody, RHBD-1 antibody, CBD1 antibody, PBD-1 antibody, DEFB1 antibody, BNBD-1 antibody, defensin beta 1 antibody, avian beta-defensin 1 antibody, defensin, beta 1 antibody, beta-defensin 1-like antibody, beta-defensin 1 antibody, DEFB1 antibody, Defb1 antibody, AvBD1 antibody, LOC100861170 antibody

Background: Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. The mature form of Beta defensin 1 is 36 amino acids.Synonyms: BD-1, BD1, Beta-defensin 1, DEFB1, DEFB101, HBD1, hBD-1

Gene ID: 1672

UniProt: P60022