Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

ERK1 antibody (AA 372-406)

MAPK3 Reactivity: Mouse, Rat, Rabbit, Hamster WB, IP, Func Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN199418
  • Target See all ERK1 (MAPK3) Antibodies
    ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))
    Binding Specificity
    • 80
    • 55
    • 23
    • 22
    • 16
    • 15
    • 15
    • 14
    • 11
    • 11
    • 11
    • 9
    • 8
    • 6
    • 5
    • 5
    • 5
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 372-406
    Reactivity
    • 253
    • 174
    • 146
    • 45
    • 20
    • 18
    • 18
    • 12
    • 11
    • 11
    • 11
    • 7
    • 7
    • 6
    • 5
    • 3
    • 3
    • 3
    • 1
    • 1
    • 1
    • 1
    Mouse, Rat, Rabbit, Hamster
    Host
    • 262
    • 27
    • 4
    • 1
    • 1
    Rabbit
    Clonality
    • 238
    • 57
    Polyclonal
    Conjugate
    • 119
    • 25
    • 22
    • 20
    • 13
    • 11
    • 7
    • 7
    • 7
    • 7
    • 7
    • 7
    • 5
    • 5
    • 5
    • 5
    • 5
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    This ERK1 antibody is un-conjugated
    Application
    • 247
    • 104
    • 86
    • 68
    • 65
    • 47
    • 42
    • 39
    • 33
    • 25
    • 18
    • 12
    • 12
    • 5
    • 3
    • 2
    • 1
    • 1
    Western Blotting (WB), Immunoprecipitation (IP), Functional Studies (Func)
    Specificity
    Recognizes rat MAPK1/Erk1 at 44kD and MAPK2/Erk2 at 42kD. Species cross-reactivity: Human, mouse, chicken and starfish. Species sequence Homology: Chinese hamster: 35/35, mouse: 34/35, human: 32/35.
    Predicted Reactivity
    Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%) Monkey, Bovine, Dog, Bat, Horse, Platypus (97%) Human, Gorilla, Gibbon, Elephant (94%) Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%) Xenopus (84%).
    Purification
    Immunoaffinity purified
    Immunogen
    Synthetic peptide (CGG-PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-terminal 35 amino acids of rat 44kD MAP Kinase 2/ Erk2 (KLH coupled). Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%), Monkey, Bovine, Dog, Bat, Horse, Platypus (97%), Human, Gorilla, Gibbon, Elephant (94%), Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%), Xenopus (84%).

    Type of Immunogen: Synthetic peptide - KLH conjugated
    Isotype
    IgG
    Top Product
    Discover our top product MAPK3 Primary Antibody
  • Application Notes
    Approved: Func, IP, WB (0.1 - 2 μg/mL)

    Usage: Suitable for use in Western Blot and Immunoprecipitation. Western Blot: 0.1-2 μg/mL detects MAP kinases in RIPA lysates of mouse 3T3/A31 fibroblasts and L6 cells. 3T3/A31 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-MAP Kinase 1/2 (0.1 μg/mL). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system. Immunoprecipitation Kinase Assay: 4 μg immunoprecipitates active MAP kinases from a lysate of NGF-stimulated (50 ng/mL) PC-12 cells, as demonstrated using the MAPK Immunoprecipitation Kinase Cascade Kit.
    Comment

    Target Species of Antibody: Rat

    Restrictions
    For Research Use only
  • Format
    Liquid
    Concentration
    Lot specific
    Buffer
    0.2 M Tris-glycine,  pH 7.4, 0.15 M sodium chloride, 0.05 % sodium azide, 0.1 mM EDTA.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Handling Advice
    Avoid repeat freeze-thaw cycles.
    Storage
    4 °C,-20 °C
    Storage Comment
    Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.
  • Target
    ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))
    Alternative Name
    MAPK3 / ERK1 (MAPK3 Products)
    Synonyms
    ERK-1 antibody, ERK1 antibody, ERT2 antibody, HS44KDAP antibody, HUMKER1A antibody, P44ERK1 antibody, P44MAPK antibody, PRKM3 antibody, p44-ERK1 antibody, p44-MAPK antibody, Erk-1 antibody, Erk1 antibody, Ert2 antibody, Esrk1 antibody, Mnk1 antibody, Mtap2k antibody, Prkm3 antibody, p44 antibody, p44erk1 antibody, p44mapk antibody, ERK3 antibody, ERK6 antibody, P38GAMMA antibody, PRKM12 antibody, SAPK-3 antibody, SAPK3 antibody, fi06b09 antibody, wu:fi06b09 antibody, zERK1 antibody, Tb08.10J17.940 antibody, MAPK1 antibody, MNK1 antibody, AW123708 antibody, Erk6 antibody, P38gamma antibody, Prkm12 antibody, Sapk3 antibody, ATMAPK3 antibody, ATMPK3 antibody, T6D9.4 antibody, mitogen-activated protein kinase 3 antibody, mitogen-activated protein kinase 3 antibody, mitogen-activated protein kinase 12 antibody, mitogen activated protein kinase 3 antibody, mitogen-activated serine/threonine-protein kinase antibody, MAPK3 antibody, Mapk3 antibody, MAPK12 antibody, mapk3 antibody, Tc00.1047053509475.10 antibody, Tb927.8.3550 antibody, Mapk12 antibody, CEK1 antibody, MPK3 antibody
    Background
    Name/Gene ID: MAPK3
    Subfamily: MAPK
    Family: Protein Kinase

    Synonyms: MAPK3, ERK-1, ERT2, HUMKER1A, HS44KDAP, MAP kinase 1, MAP kinase isoform p44, MAPK 1, MAPK 3, p44, p44MAPK, p44-MAPK, p44ERK1, Insulin-stimulated MAP2 kinase, MAP kinase 3, p44-ERK1, ERK1, PRKM3
    Gene ID
    5595
    UniProt
    P27361
    Pathways
    MAPK Signaling, RTK Signaling, Interferon-gamma Pathway, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals, S100 Proteins
You are here:
Support