NMS antibody (AA 70-103)

Catalog No. ABIN2323535

Product Details anti-NMS Antibody

Target: NMS (Neuromedin S (NMS))

Binding Specificity: AA 70-103

Reactivity: Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NMS antibody is un-conjugated

Application: ELISA

Sequence: FLFHYSRTRK PTHPVSAEFA PVHPLMRLAA KLAS

Cross-Reactivity: Mouse (Murine)

Cross-Reactivity (Details): Calculated cross reactivity: Mo

Characteristics: Neuromedin S (Neuromedin-S, NMS)

Purification: Purified by Protein A affinity chromatography

Immunogen: Synthetic peptide corresponding to aa70-103 of mouse prepro-Neuromedin S (FLFHYSRTRKPTHPVSAEFAPVHPLMRLAAKLAS).

Isotype: IgG

Application Details

Application Notes: Optimal working conditions should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Reconstitute with 115 μL ddH2O and 85 μL PBS..

Buffer: Supplied as a lyophilized powder from PBS, pH 7.5.

Storage: -20 °C

Storage Comment: -20°C

Target Details for NMS

Target: NMS (Neuromedin S (NMS))

Alternative Name: Neuromedin S (NMS Products)

Synonyms: AB164466 antibody, neuromedin S antibody, NMS antibody, nms antibody, Nms antibody