DcR1 antibody

Catalog No. ABIN2379279

Product Details anti-DcR1 Antibody

Target: DcR1 (TNFRSF10C) (Tumor Necrosis Factor Receptor Superfamily, Member 10c (TNFRSF10C))

Reactivity: Human

Host: Goat

Clonality: Polyclonal

Conjugate: This DcR1 antibody is un-conjugated

Application: Western Blotting (WB), ELISA, Flow Cytometry (FACS), Immunochromatography (IC)

Sequence: EVPQQTVAPQ QQRHSFKGEE CPAGSHRSEH TC

Cross-Reactivity: Human

Cross-Reactivity (Details): Calculated cross reactivity: Hu

Characteristics: TRAIL Receptor 3 (TRAIL R3, TNF-Related Apoptosis Inducing Receptor3)

Purification: Purified by immunoaffinity chromatography.

Immunogen: Synthetic peptide (EVPQQTVAPQQQRHSFKGEECPAGSHRSEHTC) corresponding to the extracellular domain sequence of human TRAIL-R3.

Isotype: IgG

Application Details

Application Notes: Optimal working conditions should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Liquid

Buffer: Supplied as a liquid in PBS, pH 7.2, 1 mg/mL BSA, 0.09 % sodium azide before the addition of 40 % glycerol.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: -20 °C

Storage Comment: -20°C

Target Details for DcR1

Target: DcR1 (TNFRSF10C) (Tumor Necrosis Factor Receptor Superfamily, Member 10c (TNFRSF10C))

Alternative Name: TRAIL Receptor 3 (TNFRSF10C Products)

Synonyms: CD263 antibody, DCR1 antibody, DCR1-TNFR antibody, LIT antibody, TRAIL-R3 antibody, TRAILR3 antibody, TRID antibody, TNFRSF10C antibody, TNF receptor superfamily member 10c antibody, TNFRSF10C antibody

NCBI Accession: NP_003801

Pathways: Apoptosis