ZNF566 antibody (Middle Region)

Catalog No. ABIN2787529

Product Details anti-ZNF566 Antibody

Target: ZNF566 (Zinc Finger Protein 566 (ZNF566))

Binding Specificity: Middle Region

Reactivity: Human, Cow, Horse, Rat, Dog, Pig, Rabbit, Guinea Pig, Mouse, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZNF566 antibody is un-conjugated

Application: Western Blotting (WB)

Sequence: YECKECGKAF SSGSNFTQHQ RIHTGEKPYE CKECGNAFSQ SSQLIKHQRI

Predicted Reactivity: Cow: 93%, Dog: 93%, Guinea Pig: 86%, Horse: 100%, Human: 100%, Mouse: 100%, Pig: 93%, Rabbit: 93%, Rat: 100%, Zebrafish: 93%

Characteristics: This is a rabbit polyclonal antibody against Zfp566. It was validated on Western Blot.

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI

Application Details

Application Notes: Optimal working dilutions should be determined experimentally by the investigator.

Comment:

Antigen size: 386 AA

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freeze-thaw cycles.

Storage: -20 °C

Storage Comment: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Target Details for ZNF566

Target: ZNF566 (Zinc Finger Protein 566 (ZNF566))

Alternative Name: Zfp566 (ZNF566 Products)

Synonyms: ZNF420 antibody, RGD1563239 antibody, zinc finger protein 566 antibody, ZNF566 antibody, Zfp566 antibody

Background: The function of this protein remains unknown.
Alias Symbols: RGD1563239
Protein Size: 386

Molecular Weight: 45 kDa

Gene ID: 502316

NCBI Accession: NM_001134726, NP_001128198

UniProt: B2RZ94