FMO1 antibody (C-Term)

Catalog No. ABIN3042396

Product Details anti-FMO1 Antibody

Target: FMO1 (Flavin Containing Monooxygenase 1 (FMO1))

Binding Specificity: AA 334-363, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FMO1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Dimethylaniline monooxygenase [N-oxide-forming] 1(FMO1) detection. Tested with WB in Human,Mouse, Rat.

Sequence: AFPFLDESVV KVEDGQASLY KYIFPAHLQK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Dimethylaniline monooxygenase [N-oxide-forming] 1(FMO1) detection. Tested with WB in Human,Mouse, Rat.
Gene Name: flavin containing monooxygenase 1
Protein Name: Dimethylaniline monooxygenase [N-oxide-forming] 1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human FMO1 (334-363aa AFPFLDESVVKVEDGQASLYKYIFPAHLQK), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for FMO1

Target: FMO1 (Flavin Containing Monooxygenase 1 (FMO1))

Alternative Name: FMO1 (FMO1 Products)

Synonyms: RFMO1A antibody, flavin containing monooxygenase 1 antibody, FMO1 antibody, fmo1 antibody, Fmo1 antibody

Background: Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics. Several transcript variants encoding different isoforms have been found for this gene.

Synonyms: Dimethylaniline monooxygenase [N oxide forming] 1 antibody|Dimethylaniline monooxygenase [N-oxide-forming] 1 antibody|Dimethylaniline oxidase 1 antibody|Fetal hepatic flavin containing monooxygenase 1 antibody|Fetal hepatic flavin-containing monooxygenase 1 antibody| Flavin containing monooxygenase 1 (fetal liver) antibody|Flavin Containing Monooxygenase 1 antibody|FMO 1 antibody|FMO1 antibody| FMO1_HUMAN antibody|OTTHUMP00000033536 antibody|OTTHUMP00000033537 antibody

Gene ID: 2326

UniProt: Q01740