Involucrin antibody (C-Term)

Catalog No. ABIN3042470

Product Details anti-Involucrin Antibody

Target: Involucrin (IVL)

Binding Specificity: AA 551-585, C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Involucrin antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Involucrin(IVL) detection. Tested with WB in Human.

Sequence: QVQDIQPALP TKGEVLLPVE HQQQKQEVQW PPKHK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Involucrin(IVL) detection. Tested with WB in Human.
Gene Name: involucrin
Protein Name: Involucrin

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Involucrin (551-585aa QVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK).

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for Involucrin

Target: Involucrin (IVL)

Alternative Name: IVL (IVL Products)

Synonyms: INV antibody, NPH2 antibody, NPHP2 antibody, 1110019C06Rik antibody, IVL antibody, Nphp2 antibody, inv antibody, involucrin antibody, inversin antibody, IVL antibody, INVS antibody, Ivl antibody, Invs antibody

Background: Involucrin is a protein component of human skin and in humans is encoded by the IVL gene. It is a highly reactive, soluble, transglutaminase substrate protein present in keratinocytes of epidermisand other stratified squamous epithelia. It first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase thus helping in the formation of an insoluble envelope beneath theplasma membrane functioning as a glutamyl donor during assembly of the cornified envelope. Additionally, Involucrin is synthesised in the stratum spinosum and cross linked in the stratum granulosum by thetransglutaminase enzyme that makes it highly stable. Thus it provides structural support to the cell, thereby allowing the cell to resist invasion by micro-organisms.

Synonyms: INVO_HUMAN antibody|Involucrin antibody|IVL antibody

Gene ID: 3713

UniProt: P07476