Otoferlin antibody (C-Term)

Catalog No. ABIN3042499

Product Details anti-Otoferlin Antibody

Target: Otoferlin (OTOF)

Binding Specificity: AA 1831-1863, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Otoferlin antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Otoferlin(OTOF) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: QIWDADHFSA DDFLGAIELD LNRFPRGAKT AKQ

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Otoferlin(OTOF) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: otoferlin
Protein Name: Otoferlin

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Otoferlin (1831-1863aa QIWDADHFSADDFLGAIELDLNRFPRGAKTAKQ), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for Otoferlin

Target: Otoferlin (OTOF)

Alternative Name: OTOF (OTOF Products)

Synonyms: OTOF antibody, Otof antibody, AUNB1 antibody, DFNB6 antibody, DFNB9 antibody, FER1L2 antibody, NSRD9 antibody, fj34b10 antibody, si:dkey-181f18.3 antibody, wu:fj34b10 antibody, otoferlin antibody, putative otoferlin antibody, otoferlin a antibody, OTOF antibody, LOC5565414 antibody, CpipJ_CPIJ002471 antibody, CpipJ_CPIJ010863 antibody, Smp_163750 antibody, otof antibody, Otof antibody, otofa antibody

Background: Otoferlin is a protein that in humans is encoded by the OTOF gene. Mutations in this gene are a cause of neurosensory nonsyndromic recessive deafness, DFNB9. The short form of the encoded protein has three C2 domains, a single carboxy-terminal transmembrane domain found also in the C. elegans spermatogenesis factor FER-1 and human dysferlin, while the long form has six C2 domains. The homology suggests that this protein may be involved in vesicle membrane fusion. Several transcript variants encoding multipleisoforms have been found for this gene.

Synonyms: AUNB1 antibody|Deafness, autosomal recessive 9 antibody|DFNB6 antibody|DFNB9 antibody|Fer 1 like protein 2 antibody|Fer-1-like protein 2 antibody|FER1L2 antibody|NSRD9 antibody|Otof antibody|OTOF_HUMAN antibody|Otoferlin antibody

Gene ID: 9381

Pathways: Sensory Perception of Sound, Synaptic Vesicle Exocytosis