ICA1 antibody (Middle Region)

Catalog No. ABIN3042731

Product Details anti-ICA1 Antibody

Target: ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))

Binding Specificity: AA 243-276, Middle Region

Reactivity: Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ICA1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Islet cell autoantigen 1(ICA1) detection. Tested with WB in Human,Mouse,Rat.

Sequence: EKTSHTMAAI HESFKGYQPY EFTTLKSLQD PMKK

Cross-Reactivity (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Characteristics: Rabbit IgG polyclonal antibody for Islet cell autoantigen 1(ICA1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: islet cell autoantigen 1, 69 kDa
Protein Name: Islet cell autoantigen 1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ICA1 (243-276aa EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for ICA1

Target: ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))

Alternative Name: ICA1 (ICA1 Products)

Synonyms: ica1 antibody, MGC52730 antibody, ICA1 antibody, DKFZp469G0321 antibody, zgc:92566 antibody, 69kDa antibody, ICA69 antibody, Ica69 antibody, MGC83241 antibody, ICAp69 antibody, islet cell autoantigen 1 L homeolog antibody, islet cell autoantigen 1 antibody, Islet cell autoantigen 1 antibody, islet cell autoantigen 1 S homeolog antibody, ica1.L antibody, ICA1 antibody, ica1 antibody, ica69 antibody, Ica1 antibody, ica1.S antibody

Background: Islet cell autoantigen 1 is a protein that in humans is encoded by the ICA1 gene. It is mapped to 7p22. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. What's more, this protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene.

Synonyms: 69 kDa islet cell autoantigen antibody|Diabetes mellitus type I autoantigen antibody|ICA 1 antibody|Ica1 antibody|ICA69 antibody|ICA69_HUMAN antibody|ICAp69 antibody|Islet cell autoantigen 1 (69kD) antibody|Islet cell autoantigen 1 69 kDa antibody|Islet cell autoantigen 1 antibody|Islet cell autoantigen 1 isoform antibody|Islet cell autoantigen p69 antibody|OTTHUMP00000200933 antibody|OTTHUMP00000200934 antibody|OTTHUMP00000200941 antibody|OTTHUMP00000200993 antibody|p69 antibody

Gene ID: 3382

UniProt: Q05084