DGAT1 antibody (Middle Region)

Catalog No. ABIN3043266

Product Details anti-DGAT1 Antibody

Target: DGAT1 (Diacylglycerol O-Acyltransferase 1 (DGAT1))

Binding Specificity: AA 280-318, Middle Region

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DGAT1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Diacylglycerol O-acyltransferase 1(DGAT1) detection. Tested with WB in Human,Rat.

Sequence: RRILEMLFFT QLQVGLIQQW MVPTIQNSMK PFKDMDYSR

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Diacylglycerol O-acyltransferase 1(DGAT1) detection. Tested with WB in Human,Rat.
Gene Name: diacylglycerol O-acyltransferase 1
Protein Name: Diacylglycerol O-acyltransferase 1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human DGAT1 (280-318aa RRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSR), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for DGAT1

Target: DGAT1 (Diacylglycerol O-Acyltransferase 1 (DGAT1))

Alternative Name: DGAT1 (DGAT1 Products)

Synonyms: ARAT antibody, ARGP1 antibody, DGAT antibody, C75990 antibody, D15Ertd23e antibody, Dgat antibody, dgat1 antibody, wu:fd36g11 antibody, zgc:77691 antibody, DGAT1 antibody, ABX45 antibody, AS11 antibody, ATDGAT antibody, DIACYLGLYCEROL ACYLTRANSFERASE antibody, F27F23.24 antibody, RDS1 antibody, TRIACYLGLYCEROL BIOSYNTHESIS DEFECT 1 antibody, DDBDRAFT_0202877 antibody, DDBDRAFT_0304727 antibody, DDB_0202877 antibody, DDB_0304727 antibody, zgc:92327 antibody, diacylglycerol O-acyltransferase 1 antibody, diacylglycerol O-acyltransferase 1a antibody, diacylglycerol O-acyltransferase 1 L homeolog antibody, membrane bound O-acyl transferase (MBOAT) family protein antibody, diacylglycerol O-acyltransferase Dga1 antibody, diacylglycerol O-acyltransferase 1b antibody, DGAT1 antibody, Dgat1 antibody, dgat1a antibody, dgat1.L antibody, TAG1 antibody, dgat1 antibody, MGYG_02131 antibody, Tsp_02502 antibody, LOC100283803 antibody, dga1 antibody, dgat1b antibody

Background: Acyl-CoA: diacylglycerol acyltransferase (DGAT) is a microsomal enzyme that plays a central role in the metabolism of cellular diacylglycerol lipids and catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol (DAG) and fatty acyl CoA as substrates. DGAT had been considered necessary for adipose tissue formation and essential for survival. There are two isozymes of DGAT encoded by the genes DGAT1 and DGAT2. DGAT1 is a host factor for HCV infection that binds core protein, localizes it to DGAT1-generated lipid droplets, and recruits viral RNA replication complexes for viral assembly. DGAT2-generated lipid droplets formed normally in cells treated with the DGAT1 inhibitor, suggesting that DGAT1 inhibitors may be useful as antiviral therapeutics.

Synonyms: ACAT related gene product 1 antibody|ACAT-related gene product 1 antibody|Acyl coenzyme A:cholesterol acyltransferase related gene 1 antibody|Acyl-CoA retinol O-fatty-acyltransferase antibody|Acyl-CoA:diacylglycerol acyltransferase antibody|ARAT antibody| ARGP1 antibody|C75990 antibody|D15Ertd23e antibody|Dgat antibody|DGAT1 antibody|DGAT1_HUMAN antibody|Diacylglycerol O acyltransferase 1 antibody|Diacylglycerol O-acyltransferase 1 antibody|DIAR7 antibody|Diglyceride acyltransferase antibody|EC 2.3.1.20 antibody| hCG_24006 antibody|MGC139064 antibody|Retinol O fatty acyltransferase antibody

Gene ID: 8694

UniProt: O75907

Pathways: Hormone Transport