Neuroserpin antibody (C-Term)
-
- Target See all Neuroserpin (SERPINI1) Antibodies
- Neuroserpin (SERPINI1) (serpin Peptidase Inhibitor, Clade I (neuroserpin), Member 1 (SERPINI1))
-
Binding Specificity
- AA 272-310, C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Neuroserpin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Neuroserpin(SERPINI1) detection. Tested with WB in Human,Mouse,Rat.
- Sequence
- KAQLVEEWAN SVKKQKVEVY LPRFTVEQEI DLKDVLKA
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Neuroserpin(SERPINI1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: serpin peptidase inhibitor, clade I (neuroserpin), member 1
Protein Name: Neuroserpin - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human Neuroserpin (272-310aa KAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKA L), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product SERPINI1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- Neuroserpin (SERPINI1) (serpin Peptidase Inhibitor, Clade I (neuroserpin), Member 1 (SERPINI1))
- Alternative Name
- SERPINI1 (SERPINI1 Products)
- Synonyms
- PI12 antibody, neuroserpin antibody, AI837402 antibody, Ns antibody, PI-12 antibody, Spi17 antibody, CG9453 antibody, Dmel\\CG9453 antibody, Serp2 antibody, Sp4 antibody, Spn4 antibody, Spn4A antibody, dSerp2 antibody, sp4 antibody, spn4 antibody, raPIT5a antibody, SERPINI1 antibody, pi12 antibody, MADHIP antibody, NSP antibody, SARA antibody, SMADIP antibody, serpini1l antibody, si:ch211-167c22.4 antibody, serpin family I member 1 antibody, serine (or cysteine) peptidase inhibitor, clade I, member 1 antibody, Serpin 42Da antibody, zinc finger FYVE-type containing 9 antibody, serpin peptidase inhibitor, clade I (neuroserpin), member 1 antibody, serpin family I member 1 L homeolog antibody, SERPINI1 antibody, Serpini1 antibody, Spn42Da antibody, serpini1 antibody, ZFYVE9 antibody, serpini1.L antibody
- Background
-
Neuroserpin is a protein that in humans is encoded by the SERPINI1 gene. This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator. It is thought to play a role in the regulation of axonal growth and the development of synaptic plasticity. Mutations in this gene result in familial encephalopathy with neuroserpin inclusion bodies (FENIB), which is a dominantly inherited form of familial encephalopathy and epilepsy characterized by the accumulation of mutant neuroserpin polymers. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Synonyms: DKFZp781N13156 antibody|Neuroserpin antibody|NEUS_HUMAN antibody|Peptidase inhibitor 12 antibody|PI-12 antibody|PI12 antibody|Protease inhibitor 12 antibody|Serine or cysteine proteinase inhibitor clade I (neuroserpin) member 1 antibody|Serine or cysteine proteinase inhibitor clade I member 1 antibody|Serpin I1 antibody|Serpin peptidase inhibitor clade I (neuroserpin) member 1 antibody|SERPINI1 antibody - Gene ID
- 5274
- UniProt
- Q99574
- Pathways
- Regulation of Hormone Metabolic Process
-