PIGR antibody (C-Term)

Catalog No. ABIN3043380

Product Details anti-PIGR Antibody

Target: PIGR (Polymeric Immunoglobulin Receptor (PIGR))

Binding Specificity: AA 579-613, C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIGR antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Polymeric immunoglobulin receptor(PIGR) detection. Tested with WB in Human.

Sequence: DAAPDEKVLD SGFREIENKA IQDPRLFAEE KAVAD

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Polymeric immunoglobulin receptor(PIGR) detection. Tested with WB in Human.
Gene Name: polymeric immunoglobulin receptor
Protein Name: Polymeric immunoglobulin receptor

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PIGR (579-613aa DAAPDEKVLDSGFREIENKAIQDPRLFAEEKAVAD), different from the related rat sequence by eighteen amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for PIGR

Target: PIGR (Polymeric Immunoglobulin Receptor (PIGR))

Alternative Name: PIGR (PIGR Products)

Synonyms: DKFZp469G1013 antibody, RNPIGR2 antibody, pIgA-R antibody, polymeric immunoglobulin receptor antibody, PIGR antibody, Pigr antibody

Background: Polymeric immunoglobulin receptor is a protein that in humans is encoded by the PIGR gene. It is a Fc receptor which facilitates the secretion of the soluble polymeric isoforms of immunoglobulin A and immunoglobulin M. This gene is mapped to 1q31-q41. The encoded poly-Ig receptor binds polymeric immunoglobulin molecules at the basolateral surface of epithelial cells, the complex is then transported across the cell to be secreted at the apical surface. A significant association was found between immunoglobulin A nephropathy and several SNPs in this gene.

Synonyms: Hepatocellular carcinoma associated protein TB6 antibody|Hepatocellular carcinoma-associated protein TB6 antibody|MGC125361 antibody| MGC125362 antibody|Phosphatidylinositol glycan, class R antibody|PIGR antibody|PIGR_HUMAN antibody|Poly Ig receptor antibody|Poly-Ig receptor antibody|Polymeric immunoglobulin receptor antibody|Secretory component antibody|Transmembrane secretory component antibody

Gene ID: 5284

UniProt: P01833