LIMK2 antibody (C-Term)

Catalog No. ABIN3043412

Product Details anti-LIMK2 Antibody

Target: LIMK2 (LIM Domain Kinase 2 (LIMK2))

Binding Specificity: AA 596-635, C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LIMK2 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for LIM domain kinase 2(LIMK2) detection. Tested with WB in Human,Mouse.

Sequence: KLEDSFEALS LYLGELGIPL PAELEELDHT VSMQYGLTRD

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for LIM domain kinase 2(LIMK2) detection. Tested with WB in Human,Mouse.
Gene Name: LIM domain kinase 2
Protein Name: LIM domain kinase 2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human LIM kinase 2 (596-635aa KLEDSFEALSLYLGELGIPLPAELEELDHTVSMQYGLTRD), different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for LIMK2

Target: LIMK2 (LIM Domain Kinase 2 (LIMK2))

Alternative Name: LIMK2 (LIMK2 Products)

Synonyms: xlimk2 antibody, zgc:91990 antibody, wu:fa97c09 antibody, wu:fk73e11 antibody, LIMK2 antibody, Limk2b antibody, Link2 antibody, LIMK antibody, 9430059K01 antibody, A930024P04Rik antibody, C85310 antibody, Limk2a antibody, LIM domain kinase 2 L homeolog antibody, LIM domain kinase 2 antibody, LIM motif-containing protein kinase 2 antibody, limk2.L antibody, limk2 antibody, LIMK2 antibody, Limk2 antibody

Background: LIM domain kinase 2 is an enzyme that in humans is encoded by the LIMK2 gene. There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. The protein encoded by this gene is phosphorylated and activated by ROCK, a downstream effector of Rho, and the encoded protein, in turn, phosphorylates cofilin, inhibiting its actin-depolymerizing activity. It is thought that this pathway contributes to Rho-induced reorganization of the actin cytoskeleton. At least three transcript variants encoding different isoforms have been found for this gene.

Synonyms: LIM domain kinase 2 antibody|LIMK 2 antibody|LIMK-2 antibody|Limk2 antibody|LIMK2_HUMAN antibody

Gene ID: 3985

UniProt: P53671