STXBP1 antibody (N-Term)

Catalog No. ABIN3043413

Product Details anti-STXBP1 Antibody

Target: STXBP1 (Syntaxin Binding Protein 1 (STXBP1))

Binding Specificity: AA 184-216, N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STXBP1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Syntaxin-binding protein 1(STXBP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: KEYPAVRYRG EYKDNALLAQ LIQDKLDAYK ADD

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Syntaxin-binding protein 1(STXBP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: syntaxin binding protein 1
Protein Name: Syntaxin-binding protein 1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Munc18-1 (184-216aa KEYPAVRYRGEYKDNALLAQLIQDKLDAYKADD), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for STXBP1

Target: STXBP1 (Syntaxin Binding Protein 1 (STXBP1))

Alternative Name: STXBP1 (STXBP1 Products)

Synonyms: MUNC18-1 antibody, NSEC1 antibody, P67 antibody, RBSEC1 antibody, UNC18 antibody, AI317162 antibody, AI326233 antibody, MMS10-G antibody, Ms10g antibody, Munc-18a antibody, Munc18-1 antibody, N-sec1 antibody, Rb-sec1 antibody, Sxtbp1 antibody, Unc18-1 antibody, Unc18h antibody, nsec1 antibody, fj43h10 antibody, stxbp1 antibody, wu:fj36d12 antibody, wu:fj43h10 antibody, zgc:114171 antibody, rop antibody, unc18 antibody, hunc18 antibody, rbsec1 antibody, munc18-1 antibody, MGC146482 antibody, ANC18HA antibody, NSEC1A antibody, Sec1 antibody, n-sec1 antibody, nSec1 antibody, rbSec1 antibody, rbSec1A antibody, rbSec1B antibody, UNC18A antibody, si:rp71-10d23.3 antibody, syntaxin binding protein 1 antibody, syntaxin binding protein 1a antibody, syntaxin binding protein 1 L homeolog antibody, syntaxin binding protein 1b antibody, STXBP1 antibody, Stxbp1 antibody, stxbp1a antibody, stxbp1 antibody, Tb09.160.0780 antibody, stxbp1.L antibody, stxbp1b antibody

Background: Syntaxin-binding protein 1, also known as Munc18-1, is a protein that in humans is encoded by the STXBP1 gene. By fluorescence in situ hybridization, the STXBP1 gene is mapped to chromosome 9q34.1. This gene encodes a syntaxin-binding protein. The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, a transmembrane attachment protein receptor. Mutations in this gene have been associated with infantile epileptic encephalopathy-4. Alternatively spliced transcript variants have been described.

Synonyms: FLJ37475 antibody|Munc 18 1 antibody|Munc 18a antibody|MUNC18 1 antibody|N-Sec1 antibody|Neuronal SEC1 antibody|NSec1 antibody|p67 antibody|Protein unc-18 homolog 1 antibody|Protein unc-18 homolog A antibody|Rb sec1 antibody|RBSEC1 antibody|STXB1_HUMAN antibody| STXBP1 antibody|Syntaxin binding protein 1 antibody|Syntaxin-binding protein 1 antibody|Unc 18 homolog antibody|Unc 18A antibody|Unc-18A antibody|Unc18 1 antibody|UNC18 antibody|Unc18-1 antibody

Gene ID: 6812

UniProt: P61764

Pathways: Synaptic Vesicle Exocytosis, Dicarboxylic Acid Transport