RUNX2 antibody (Middle Region)

Catalog No. ABIN3043428

Product Details anti-RUNX2 Antibody

Target: RUNX2 (Runt-Related Transcription Factor 2 (RUNX2))

Binding Specificity: AA 244-278, Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RUNX2 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Runt-related transcription factor 2(RUNX2) detection. Tested with WB in Human.

Sequence: DRLSDLGRIP HPSMRVGVPP QNPRPSLNSA PSPFN

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Runt-related transcription factor 2(RUNX2) detection. Tested with WB in Human.
Gene Name: runt-related transcription factor 2
Protein Name: Runt-related transcription factor 2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human RUNX2(244-278aa DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN), identical to the related mouse sequence.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, The detection limit for RUNX2 is approximately 0.25 ng/lane under reducing conditions.
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-RUNX2 antibody (ABIN3043428)

Yao, Zhao, Ou, Liang, Lin, Wang: "MicroRNA-214 Suppresses Osteogenic Differentiation of Human Periodontal Ligament Stem Cells by Targeting ATF4." in: Stem cells international, Vol. 2017, pp. 3028647, (2017) (PubMed).

Wang, Wang, Dai, Chen, Yang, Dai, Ou, Wang, Lin: "Effects of Intermittent Administration of Parathyroid Hormone (1-34) on Bone Differentiation in Stromal Precursor Antigen-1 Positive Human Periodontal Ligament Stem Cells." in: Stem cells international, Vol. 2016, pp. 4027542, (2016) (PubMed).

Li, Chen, Peng, Zhou, Fang: "Pulsed electromagnetic fields protect the balance between adipogenesis and osteogenesis on steroid-induced osteonecrosis of femoral head at the pre-collapse stage in rats." in: Bioelectromagnetics, Vol. 35, Issue 3, pp. 170-80, (2014) (PubMed).

Song, Yu, Zhao, Wei, Liu, Hu, Zhao, Yang, Wu: "The time-dependent manner of sinusoidal electromagnetic fields on rat bone marrow mesenchymal stem cells proliferation, differentiation, and mineralization." in: Cell biochemistry and biophysics, Vol. 69, Issue 1, pp. 47-54, (2014) (PubMed).

Mu, Lv, Wang, Ma, Ma, Liu, Yu, Mu: "Mechanical stress stimulates the osteo/odontoblastic differentiation of human stem cells from apical papilla via erk 1/2 and JNK MAPK pathways." in: BioMed research international, Vol. 2014, pp. 494378, (2014) (PubMed).

Shan, Zhou, Yang, Yan, Zhang, Fu, Jiang: "Lithium chloride promotes the odontoblast differentiation of hair follicle neural crest cells by activating Wnt/?-catenin signaling." in: Cell biology international, (2014) (PubMed).

Xue, Wu, Zhou, Ma, Wang, Liu, Ma, Li: "IGF1 promotes osteogenic differentiation of mesenchymal stem cells derived from rat bone marrow by increasing TAZ expression." in: Biochemical and biophysical research communications, Vol. 433, Issue 2, pp. 226-31, (2013) (PubMed).

Wang, Mu, Fan, Yu, Yan, Lei, Tang, Wang, Zheng, Yu, Zhang: "Insulin-like growth factor 1 can promote the osteogenic differentiation and osteogenesis of stem cells from apical papilla." in: Stem cell research, Vol. 8, Issue 3, pp. 346-56, (2012) (PubMed).

Liu, Zhong, Liang, Fu, Luo, Zhou, Gou, Huang: "Effect of high glucose levels on the calcification of vascular smooth muscle cells by inducing osteoblastic differentiation and intracellular calcium deposition via BMP-2/Cbfα-1 pathway." in: Journal of Zhejiang University. Science. B, Vol. 11, Issue 12, pp. 905-11, (2010) (PubMed).

Target Details for RUNX2

Target: RUNX2 (Runt-Related Transcription Factor 2 (RUNX2))

Alternative Name: RUNX2 (RUNX2 Products)

Synonyms: AML3 antibody, CBF-alpha-1 antibody, CBFA1 antibody, CCD antibody, CCD1 antibody, CLCD antibody, OSF-2 antibody, OSF2 antibody, PEA2aA antibody, PEBP2aA antibody, Cbf antibody, Cbfa-1 antibody, Cbfa1 antibody, LS3 antibody, Osf2 antibody, Pebp2a1 antibody, Pebpa2a antibody, runx2 antibody, RUNX2 antibody, ccd antibody, aml3 antibody, ccd1 antibody, osf2 antibody, cbfa1 antibody, pea2aa antibody, pebp2a1 antibody, pebp2a2 antibody, pebp2aa antibody, pebp2aa1 antibody, runt related transcription factor 2 antibody, runt-related transcription factor 2a antibody, runt-related transcription factor 2 antibody, runt related transcription factor 2 L homeolog antibody, RUNX2 antibody, runx2a antibody, Runx2 antibody, runx2 antibody, LOC703331 antibody, LOC100549663 antibody, runx2.L antibody

Background: Core binding factor A1 (CBFA1/RUNX2) is a runt-like transcription factor essential for osteoblast differentiation. This protein is a member of the RUNX family of transcription factors and has a Runt DNA-binding domain. It is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. RUNX2 plays a non-redundant role for Cbfa1 in tooth development that may be distinct from that in bone formation. In odontogenesis, RUNX2 is not involved in the early signaling networks regulating tooth initiation and early morphogenesis but regulates key epithelial-mesenchymal interactions that control advancing morphogenesis and histodifferentiation of the epithelial enamel organ.

Synonyms: Acute myeloid leukemia 3 protein antibody|Alpha subunit 1 antibody|AML3 antibody|CBF alpha 1 antibody|CBF-alpha-1 antibody|CBFA1 antibody|CCD antibody|CCD1 antibody|Cleidocranial dysplasia 1 antibody|Core binding factor antibody|Core binding factor runt domain alpha subunit 1 antibody|Core binding factor subunit alpha 1 antibody|Core-binding factor subunit alpha-1 antibody|MGC120022 antibody|MGC120023 antibody|Oncogene AML 3 antibody|Oncogene AML-3 antibody|OSF 2 antibody|OSF-2 antibody|OSF2 antibody|Osteoblast specific transcription factor 2 antibody|Osteoblast-specific transcription factor 2 antibody|OTTHUMP00000016533 antibody|PEA2 alpha A antibody|PEA2-alpha A antibody|PEA2aA antibody|PEBP2 alpha A antibody|PEBP2-alpha A antibody|PEBP2A1 antibody|PEBP2A2 antibody|PEBP2aA antibody|PEBP2aA antibody|PEBP2aA1 antibody|Polyomavirus enhancer binding protein 2 alpha A subunit antibody|Polyomavirus enhancer-binding protein 2 alpha A subunit antibody|Runt domain antibody|Runt related transcription factor 2 antibody|Runt-related transcription factor 2 antibody|RUNX2 antibody|RUNX2_HUMAN antibody|SL3 3 enhancer factor 1 alpha A subunit antibody|SL3-3 enhancer factor 1 alpha A subunit antibody|SL3/AKV core binding factor alpha A subunit antibody|SL3/AKV core-binding factor alpha A subunit antibody

Gene ID: 860

UniProt: Q13950