LYZ antibody (C-Term)

Catalog No. ABIN3043465

Product Details anti-LYZ Antibody

Target: LYZ (Lysozyme (LYZ))

Binding Specificity: AA 106-141, C-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LYZ antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Lysozyme C(LYZ) detection. Tested with WB, IHC-P in Human,Rat.

Sequence: NIADAVACAK RVVRDPQGIR AWVAWRNRCQ NRDVRQ

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Lysozyme C(LYZ) detection. Tested with WB, IHC-P in Human,Rat.
Gene Name: lysozyme
Protein Name: Lysozyme C

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Lysozyme (106-141aa NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ).

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-LYZ antibody (ABIN3043465)

Xu, Liu, Liu, Han, Zhang, Zhao: "Dynamic changes and mechanism of intestinal endotoxemia in partially hepatectomized rats." in: World journal of gastroenterology, Vol. 13, Issue 26, pp. 3592-7, (2007) (PubMed).

Target Details for LYZ

Target: LYZ (Lysozyme (LYZ))

Alternative Name: LYZ (LYZ Products)

Synonyms: LZM antibody, 1 antibody, LYZC antibody, lys-C antibody, zgc:136734 antibody, BmLys antibody, LYS antibody, LZ antibody, LYZS antibody, lysozyme C antibody, LYZ antibody, lysozyme antibody, lysozyme antibody, lysozyme (renal amyloidosis) antibody, lysozyme L homeolog antibody, serum lysozyme antibody, LYZ antibody, lyz antibody, Lzm antibody, LOC781146 antibody, lyz.L antibody, S-LZ antibody

Background: In humans, the lysozyme enzyme is encoded by the LYZ gene. This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta [1-4] glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis.

Synonyms: 1 4 beta n acetylmuramidase c antibody|1 antibody|4-beta-N-acetylmuramidase C antibody|EC 3.2.1.17 antibody|LYSC_HUMAN antibody| Lysosyme antibody|Lysozyme (renal amyloidosis) antibody|Lysozyme C antibody|Lysozyme C precursor antibody|Lyz antibody|LZM antibody| Renal amyloidosis antibody

Gene ID: 4069

UniProt: P61626