RAB11A antibody (C-Term)

Catalog No. ABIN3043558

Product Details anti-RAB11A Antibody

Target: RAB11A (RAB11A, Member RAS Oncogene Family (RAB11A))

Binding Specificity: AA 171-211, C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB11A antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Ras-related protein Rab-11A(RAB11A) detection. Tested with WB in Human.

Sequence: EIYRIVSQKQ MSDRRENDMS PSNNVVPIHV PPTTENKPKV Q

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Ras-related protein Rab-11A(RAB11A) detection. Tested with WB in Human.
Gene Name: RAB11A, member RAS oncogene family
Protein Name: Ras-related protein Rab-11A

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Rab11A (171-211aa EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for RAB11A

Target: RAB11A (RAB11A, Member RAS Oncogene Family (RAB11A))

Alternative Name: RAB11A (RAB11A Products)

Synonyms: rab11 antibody, RAB11A antibody, wu:fi15h09 antibody, zgc:103679 antibody, yl8 antibody, Rab11a antibody, rab11A antibody, DDBDRAFT_0190819 antibody, DDBDRAFT_0191190 antibody, DDB_0190819 antibody, DDB_0191190 antibody, YL8 antibody, RAB11 antibody, RAB11A, member RAS oncogene family S homeolog antibody, RAB11A, member RAS oncogene family antibody, RAB11a, member RAS oncogene family antibody, Rab11 GTPase antibody, rab11A protein antibody, Rab11a, GTPase antibody, Rab GTPase antibody, rab11A, RAB family GTPase antibody, rab11a.S antibody, RAB11A antibody, rab11a antibody, Rab11a antibody, rab11A antibody

Background: Ras-related protein Rab-11A is a protein that in humans is encoded by the RAB11A gene. The protein encoded by this gene belongs to the small GTPase superfamily, Rab family which plays essential roles in vesicle and granule targeting. It is mapped to 15q22.31. RAB11A is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Additionally, RAB11A can control intracellular trafficking of the innate immune receptor TLR4, and thereby also receptor signaling. It has been shown to interact with RAB11FIP2, RAB11FIP4, and RAB11FIP1 and so on.

Synonyms: MGC1490 antibody|Rab 11 antibody|Rab 11A antibody|RAB 11A member oncogene family antibody|RAB 11A, member oncogene family antibody| Rab-11 antibody|RAB11 A antibody|RAB11 antibody|RAB11A antibody|RAB11A member RAS oncogene family antibody|Ras related protein Rab 11A antibody|Ras related protein Rab11A antibody|Ras-related protein Rab-11A antibody|YL 8 antibody|YL8 antibody

Gene ID: 8766

UniProt: P62491

Pathways: Regulation of Cell Size, Thromboxane A2 Receptor Signaling, Regulation of long-term Neuronal Synaptic Plasticity