NQO1 antibody (NAD(P)H Dehydrogenase, Quinone 1) (AA 242-274)

Details for Product anti-NQO1 Antibody No. ABIN3043574, Supplier: Log in to see
  • zgc:77191
  • wu:fb63c10
  • nqo1
  • DHQU
  • DIA4
  • DTD
  • NMOR1
  • QR1
  • Dia4
  • AV001255
  • Dtd
  • Nmo-1
  • Nmo1
  • Nmor1
  • Ox-1
  • Ox1
  • Qr1
  • NADPH-d
  • NAD(P)H dehydrogenase, quinone 1
  • nqo1
  • NQO1
  • Bpet2092
  • Nqo1
AA 242-274, C-Term
Human, Rat (Rattus)
This NQO1 antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Purpose Rabbit IgG polyclonal antibody for NAD(P)H dehydrogenase [quinone] 1(NQO1) detection. Tested with WB in Human,Rat.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human NQO1 (242-274aa EVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK), different from the related mouse and rat sequences by five amino acids.
Isotype IgG
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for NAD(P)H dehydrogenase [quinone] 1(NQO1) detection. Tested with WB in Human,Rat.
Gene Name: NAD(P)H dehydrogenase, quinone 1
Protein Name: NAD(P)H dehydrogenase [quinone] 1
Purification Immunogen affinity purified.
Alternative Name NQO1 (NQO1 Antibody Abstract)
Background This gene is a member of the NAD(P)H dehydrogenase (quinone) family and encodes a cytoplasmic 2-electron reductase. And this FAD-binding protein forms homodimers and reduces quinones to hydroquinones. In addition, this protein's enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Mutations in this gene have been associated with tardive dyskinesia (TD), an increased risk of hematotoxicity after exposure to benzene, and susceptibility to various forms of cancer. Altered expression of this protein has been seen in many tumors and is also associated with Alzheimer's disease (AD). Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Synonyms: Azoreductase antibody|Cytochrome b 5 reductase antibody|DHQU antibody|DIA 4 antibody|DIA4 antibody|Diaphorase (NADH/NADPH) (cytochrome b 5 reductase) antibody|Diaphorase (NADH/NADPH) antibody|Diaphorase 4 antibody|Dioxin inducible 1 antibody|DT diaphorase antibody|DT-diaphorase antibody|DTD antibody|Menadione reductase antibody|NAD(P)H dehydrogenase [quinone] 1 antibody|NAD(P)H dehydrogenase quinone 1 antibody|NAD(P)H menadione oxidoreductase 1 dioxin inducible antibody|NAD(P)H: menadione oxidoreductase 1 dioxin inducible 1 antibody|NAD(P)H:menadione oxidoreductase 1 antibody|NAD(P)H:Quinone acceptor oxidoreductase type 1 antibody|NAD(P)H:quinone oxidoreductase 1 antibody| NAD(P)H:quinone oxireductase antibody|NMOR 1 antibody|NMOR I antibody|NMOR1 antibody|NMORI antibody|NQO 1 antibody|NQO1 antibody|NQO1_HUMAN antibody|Phylloquinone reductase antibody| QR 1 antibody|QR1 antibody|Quinone reductase 1 antibody
Gene ID 1728
UniProt P15559
Research Area Signaling, Metabolism
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
Supplier Images
Western Blotting (WB) image for anti-NQO1 antibody (NAD(P)H Dehydrogenase, Quinone 1) (AA 242-274) (ABIN3043574) Anti- NQO1 Picoband antibody, Western blotting All lanes: Anti NQO1 at 0.5ug/ml Lane...