OTX2 antibody (C-Term)

Catalog No. ABIN3043586

Product Details anti-OTX2 Antibody

Target: OTX2 (Orthodenticle Homeobox 2 (OTX2))

Binding Specificity: AA 258-289, C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OTX2 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Homeobox protein OTX2(OTX2) detection. Tested with WB in Human.

Sequence: DYKDQTASWK LNFNADCLDY KDQTSSWKFQ VL

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Homeobox protein OTX2(OTX2) detection. Tested with WB in Human.
Gene Name: orthodenticle homeobox 2
Protein Name: Homeobox protein OTX2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Otx2 (258-289aa DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL), identical to the related mouse sequence.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, The detection limit for Otx2 is approximately 0.1 ng/lane under reducing conditions.
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for OTX2

Target: OTX2 (Orthodenticle Homeobox 2 (OTX2))

Alternative Name: OTX2 (OTX2 Products)

Synonyms: CPHD6 antibody, MCOPS5 antibody, E130306E05Rik antibody, id:ibd2915 antibody, zOtx2 antibody, zgc:136535 antibody, zotx-2 antibody, Xotx-2 antibody, Xotx2 antibody, otx-2 antibody, otx2 antibody, orthodenticle homeobox 2 antibody, orthodenticle homeobox 2 S homeolog antibody, orthodenticle homeobox 2 L homeolog antibody, OTX2 antibody, Otx2 antibody, otx2 antibody, otx2.S antibody, otx2.L antibody

Background: OTX2 is also known as CPHD6 or MCOPS5. This gene encodes a member of the bicoid subfamily of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and plays a role in brain, craniofacial, and sensory organ development. The encoded protein also influences the proliferation and differentiation of dopaminergic neuronal progenitor cells during mitosis. Mutations in this gene cause syndromic microphthalmia 5 (MCOPS5) and combined pituitary hormone deficiency 6 (CPHD6). This gene is also suspected of having an oncogenic role in medulloblastoma. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Pseudogenes of this gene are known to exist on chromosomes two and nine.

Synonyms: CPHD6 antibody|Homeobox protein OTX2 antibody|MCOPS 5 antibody|MCOPS5 antibody|MGC45000 antibody|Orthodenticle 2 antibody|Orthodenticle homeobox 2 antibody|Orthodenticle homolog 2 (Drosophila) antibody|Orthodenticle homolog 2 antibody|Orthodenticle2 antibody|Otx 2 antibody|otx2 antibody|OTX2_HUMAN antibody

Gene ID: 5015

UniProt: P32243

Pathways: Dopaminergic Neurogenesis