CHEK2 antibody (C-Term)

Catalog No. ABIN3043811

Product Details anti-CHEK2 Antibody

Target: CHEK2 (Checkpoint Kinase 2 (CHEK2))

Binding Specificity: AA 465-498, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHEK2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase Chk2(CHEK2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: KLLVVDPKAR FTTEEALRHP WLQDEDMKRK FQDL

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase Chk2(CHEK2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: checkpoint kinase 2
Protein Name: Serine/threonine-protein kinase Chk2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Chk2 (465-498aa KLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDL), different from the related mouse sequence by four amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for CHEK2

Target: CHEK2 (Checkpoint Kinase 2 (CHEK2))

Alternative Name: CHEK2 (CHEK2 Products)

Synonyms: CDS1 antibody, CHK2 antibody, HuCds1 antibody, LFS2 antibody, PP1425 antibody, RAD53 antibody, hCds1 antibody, fa66f08 antibody, wu:fa66f08 antibody, zgc:55865 antibody, Cds1 antibody, HUCDS1 antibody, Rad53 antibody, Chk2 antibody, cds1 antibody, chek2 antibody, chk2 antibody, hucds1 antibody, lfs2 antibody, pp1425 antibody, rad53 antibody, checkpoint kinase 2 antibody, serine/threonine-protein kinase chk2 antibody, checkpoint kinase 2 L homeolog antibody, CHEK2 antibody, chek2 antibody, Chek2 antibody, MCYG_07308 antibody, chek2.L antibody

Background: CHK2, a protein kinase that is activated in response to DNA damage, is involved in cell cycle arrest. Mapped on 22q12.1, CHK2 has a potential regulatory region rich in SQ and TQ amino acid pairs. It regulates BRCA1 function after DNA damage by phosphorylating serine-988 of BRCA1. Additionally, CHK2 can be modified by phosphorylation and activated in response to ionizing radiation, and can be also modified in response to hydroxyurea treatment. Furthermore, oligomerization of CHEK2 increases the efficiency of transautophosphorylation, resulting in the release of active CHEK2 monomers that proceed to enforce checkpoint control in irradiated cells. Moreover, CHK2 is a tumor suppressor gene conferring predisposition to sarcoma, breast cancer, and brain tumors, and that their observations provided a link between the central role of p53 inactivation in human cancer and the well-defined G2 checkpoint in yeast. There is a wide expression of small amounts of CHK2 mRNA with larger amounts in human testis, spleen, colon, and peripheral blood leukocytes.

Synonyms: bA444G7 antibody|CDS 1 antibody|CDS1 antibody|Checkpoint kinase 2 antibody|Checkpoint like protein CHK2 antibody|Chek 2 antibody|Chek2 antibody|Chk 2 antibody|CHK2 checkpoint homolog (S. pombe) antibody|CHK2 checkpoint homolog antibody|CHK2_HUMAN antibody|HuCds 1 antibody| HuCds1 antibody|LFS 2 antibody|LFS2 antibody|PP1425 antibody|RAD 53 antibody|RAD53 antibody|Rad53 homolog antibody|Serine/threonine protein kinase Chk2 antibody| Serine/ threonine-protein kinase Chk2 antibody

Gene ID: 11200

UniProt: O96017

Pathways: p53 Signaling, Apoptosis, Cell Division Cycle