IDH1 antibody (C-Term)

Catalog No. ABIN3043855

Product Details anti-IDH1 Antibody

Target: IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))

Binding Specificity: AA 381-413, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IDH1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Isocitrate dehydrogenase [NADP] cytoplasmic(IDH1) detection. Tested with WB, IHC-P in Human,Mouse, Rat.

Sequence: KGLPNVQRSD YLNTFEFMDK LGENLKIKLA QAK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Isocitrate dehydrogenase [NADP] cytoplasmic(IDH1) detection. Tested with WB, IHC-P in Human,Mouse, Rat.
Gene Name: isocitrate dehydrogenase 1 (NADP+), soluble
Protein Name: Isocitrate dehydrogenase [NADP] cytoplasmic

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IDH1 (381-413aa KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-IDH1 antibody (ABIN3043855)

Li, Zhao, Qi, Wang, Zhang, Li, Qin: "lncRNA Ftx promotes aerobic glycolysis and tumor progression through the PPARγ pathway in hepatocellular carcinoma." in: International journal of oncology, Vol. 53, Issue 2, pp. 551-566, (2018) (PubMed).

Target Details for IDH1

Target: IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))

Alternative Name: IDH1 (IDH1 Products)

Background: Isocitrate dehydrogenase 1 (NADP+), soluble is an enzyme that in humans is encoded by the IDH1 gene. Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

Synonyms: Cytosolic NADP isocitrate dehydrogenase antibody|Cytosolic NADP-isocitrate dehydrogenase antibody|Epididymis luminal protein 216 antibody|Epididymis secretory protein Li 26 antibody|HEL-216 antibody|HEL-S-26 antibody|ICDH antibody|IDCD antibody|IDH antibody|IDH1 antibody|IDHC_HUMAN antibody|IDP antibody|IDPC antibody|Isocitrate dehydrogenase [NADP] cytoplasmic antibody|Isocitrate dehydrogenase 1 (NADP+) soluble antibody|NADP dependent isocitrate dehydrogenase cytosolic antibody|NADP dependent isocitrate dehydrogenase peroxisomal antibody|NADP(+)-specific ICDH antibody|Oxalosuccinate decarboxylase antibody|PICD antibody

Gene ID: 3417

UniProt: O75874

Pathways: Warburg Effect