ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1) (AA 621-650), (Middle Region) antibody

Details for Product No. ABIN3043967, Supplier: Log in to see
Antigen
  • MDR1
  • xemdr
  • ABC20
  • CD243
  • CLCS
  • GP170
  • P-GP
  • PGY1
  • p-gp
  • Abcb1
  • Mdr1a
  • ABCB1
  • PGP1
  • Mdr1
  • Mdr1b
  • Pgy-1
  • Pgy1
  • mdr
  • Mdr
  • Cd243
  • Mdr-1
  • Mod-2
  • Mod-2r
  • Mod-2s
  • Mod2-r
  • Mod2-s
  • ATP-binding cassette, sub-family B (MDR/TAP), member 1
  • ATP-binding cassette, sub-family B (MDR/TAP), member 1A
  • ATP-binding cassette, sub-family B (MDR/TAP), member 1B
  • ATP-binding cassette, subfamily B (MDR/TAP), member 1B
  • malic enzyme complex, mitochondrial
  • ABCB1
  • abcb1
  • Abcb1a
  • Abcb1b
  • Mod2
Epitope
AA 621-650, Middle Region
38
36
13
9
8
4
3
3
2
2
2
2
2
1
1
1
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
268
27
17
13
10
8
8
2
2
1
1
1
1
1
1
1
1
1
Host
Rabbit
182
97
Clonality
Polyclonal
Conjugate
Un-conjugated
14
9
9
7
5
5
4
4
4
4
4
4
4
4
4
3
2
2
2
2
2
1
1
1
Application
Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
141
82
74
74
37
34
24
23
8
7
6
3
3
3
2
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Purpose Rabbit IgG polyclonal antibody for Multidrug resistance protein 1(ABCB1) detection. Tested with IHC-P, IHC-F in Human,Mouse,Rat.
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human P Glycoprotein(621-650aa IYFKLVTMQTAGNEVELENAADESKSEIDA), different from the related rat sequence by twelve amino acids.
Sequence IYFKLVTMQT AGNEVELENA ADESKSEIDA
Isotype IgG
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Multidrug resistance protein 1(ABCB1) detection. Tested with IHC-P, IHC-F in Human,Mouse,Rat.
Gene Name: ATP-binding cassette, sub-family B (MDR/TAP), member 1
Protein Name: Multidrug resistance protein 1
Purification Immunogen affinity purified.
Alternative Name ABCB1 (ABCB1 Antibody Abstract)
Background P-GP, also called ABCB1 or PGY1, is a glycoprotein that in humans is encoded by the ABCB1 gene. It is mapped to 7q21.12. P-GP is a well-characterized ABC-transporter (which transports a wide variety of substrates across extra- and intracellular membranes) of the MDR/TAP subfamily. It is an important protein of the cell membrane that pumps many foreign substances out of cells. More formally, it is an ATP-dependent drug efflux pump with broad substrate specificity. P-GP is an ATP-dependent drug efflux pump forxenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier.

Synonyms: ABC20 antibody|ABCB1 antibody|ATP binding cassette, sub family B (MDR/TAP), member 1 antibody|ATP-binding cassette sub-family B member 1 antibody|CD243 antibody|CLCS antibody|Colchicin sensitivity antibody|Doxorubicin resistance antibody|GP170 antibody|MDR1 antibody|MDR1_HUMAN antibody|Multidrug resistance 1 antibody|Multidrug resistance protein 1 antibody|P glycoprotein 1 antibody|P gp antibody|P-glycoprotein 1 antibody|PGY1 antibody
Gene ID 5243
UniProt P08183
Application Notes IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
IHC-F: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Comment

Antibody can be supported by ABIN921231 in IHC(P) and IHC(F).

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Thimerosal, 0.05 mg Sodium azide.
Preservative Thimerosal (Merthiolate), Sodium azide
Precaution of Use This product contains Sodium azide and Thimerosal (Merthiolate): POISONOUS AND HAZARDOUS SUBSTANCES which should be handled by trained staff only.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
Supplier Images
Immunohistochemistry (IHC) image for anti-ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1) (AA 621-650), (Middle Region) antibody (ABIN3043967) Anti-P Glycoprotein Picoband antibody, IHC(P): Mouse Kidney Tissue
Immunohistochemistry (IHC) image for anti-ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1) (AA 621-650), (Middle Region) antibody (ABIN3043967) Anti-P Glycoprotein Picoband antibody, IHC(F): Rat Kidney Tissue
Immunohistochemistry (IHC) image for anti-ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1) (AA 621-650), (Middle Region) antibody (ABIN3043967) Anti-P Glycoprotein Picoband antibody, IHC(P): Rat Kidney Tissue
Immunohistochemistry (IHC) image for anti-ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1) (AA 621-650), (Middle Region) antibody (ABIN3043967) Anti-P Glycoprotein Picoband antibody, IHC(F): Mouse Intestine Tissue
Immunohistochemistry (IHC) image for anti-ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1) (AA 621-650), (Middle Region) antibody (ABIN3043967) Anti-P Glycoprotein Picoband antibody, IHC(P): Human Lung Cancer Tissue
Product cited in: Wang, Deng, Lu, Xu, Yan, Ye, Chen et al.: "Gambogic acid as a non-competitive inhibitor of ATP-binding cassette transporter B1 reverses the multidrug resistance of human epithelial cancers by promoting ATP-binding cassette transporter B1 ..." in: Basic & clinical pharmacology & toxicology, Vol. 112, Issue 1, pp. 25-33, 2012 (PubMed).

Gao, Liu, Wang, Lin, Zhang: "Effects of Lewis Y antigen on the gene expression of multiple drug resistance-associated proteins in human ovarian cancer RMG-I-H cells." in: Medical oncology (Northwood, London, England), Vol. 27, Issue 3, pp. 960-7, 2010 (PubMed).

Did you look for something else?