NONO antibody (N-Term)

Catalog No. ABIN3044530

Product Details anti-NONO Antibody

Target: NONO (Non-POU Domain Containing, Octamer-Binding (NONO))

Binding Specificity: AA 1-35, N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NONO antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Non-POU domain-containing octamer-binding protein(NONO) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: MQSNKTFNLE KQNHTPRKHH QHHHQQQHHQ QQQQQ

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Non-POU domain-containing octamer-binding protein(NONO) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: non-POU domain containing, octamer-binding
Protein Name: Non-POU domain-containing octamer-binding protein

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human nmt55/p54nrb (1-35aa MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for NONO

Target: NONO (Non-POU Domain Containing, Octamer-Binding (NONO))

Alternative Name: NONO (NONO Products)

Synonyms: NMT55 antibody, NRB54 antibody, P54 antibody, P54NRB antibody, nmt55 antibody, nrb54 antibody, p54nrb antibody, xp54nrb antibody, AA407051 antibody, AV149256 antibody, nonA antibody, non-POU domain containing octamer binding antibody, non-POU domain containing, octamer-binding antibody, non-POU domain containing, octamer binding L homeolog antibody, non-POU-domain-containing, octamer binding protein antibody, NONO antibody, Nono antibody, nono.L antibody

Background: Non-POU domain-containing octamer-binding protein is a protein that in humans is encoded by the NONO gene. This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16.

Synonyms: 52 kDa subunit antibody|54 kDa nuclear RNA and DNA binding protein antibody|54 kDa nuclear RNA- and DNA-binding protein antibody|55 kDa nuclear protein antibody|DNA binding p52/p100 complex 52 kDa subunit antibody|DNA-binding p52/p100 complex antibody|NMT 55 antibody|NMT55 antibody|Non Pou domain containing octamer (ATGCAAAT) binding protein antibody|Non POU domain containing octamer binding antibody|Non POU domain containing octamer binding protein antibody|Non-POU domain-containing octamer-binding protein antibody|Nono antibody|NonO protein antibody|NONO_HUMAN antibody|NRB 54 antibody|NRB antibody|NRB54 antibody|Nuclear RNA binding protein 54kD antibody|P54 antibody|p54(nrb) antibody|p54nrb antibody|PPP1R114 antibody|Protein phosphatase 1 regulatory subunit 114 antibody

Gene ID: 4841

UniProt: Q15233