STAU1/Staufen antibody (C-Term)

Catalog No. ABIN3044550

Product Details anti-STAU1/Staufen Antibody

Target: STAU1/Staufen (STAU1) (Staufen Double-Stranded RNA Binding Protein 1 (STAU1))

Binding Specificity: AA 532-568, C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STAU1/Staufen antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Double-stranded RNA-binding protein Staufen homolog 1(STAU1) detection. Tested with WB in Human.

Sequence: HGIGKDVESC HDMAALNILK LLSELDQQST EMPRTGN

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Double-stranded RNA-binding protein Staufen homolog 1(STAU1) detection. Tested with WB in Human.
Gene Name: staufen double-stranded RNA binding protein 1
Protein Name: Double-stranded RNA-binding protein Staufen homolog 1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Staufen (532-568aa HGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGN), identical to the related mouse sequence.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for STAU1/Staufen

Target: STAU1/Staufen (STAU1) (Staufen Double-Stranded RNA Binding Protein 1 (STAU1))

Alternative Name: STAU1 (STAU1 Products)

Synonyms: STAU1 antibody, DKFZp459A0124 antibody, CG5753 antibody, Dmel\\CG5753 antibody, Dmstau antibody, STAU antibody, Stau antibody, Stauf antibody, dStau antibody, stau antibody, XStau antibody, XStau1 antibody, Staufen antibody, Staufen1 antibody, MGC145034 antibody, 5830401L18Rik antibody, AW549911 antibody, C85792 antibody, fi67e05 antibody, wu:fi67e05 antibody, zgc:77271 antibody, staufen double-stranded RNA binding protein 1 antibody, staufen antibody, RNA binding protein homolog antibody, staufen (RNA binding protein) homolog 1 (Drosophila) antibody, staufen double-stranded RNA binding protein 1 L homeolog antibody, STAU1 antibody, stau antibody, stau1 antibody, STAUFEN antibody, Stau1 antibody, stau1.L antibody

Background: Double-stranded RNA-binding protein Staufen homolog 1 is a protein that in humans is encoded by the STAU1 gene. Staufen is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen encoded by STAU, in addition contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU gene product has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER, the site of translation. Five transcript variants resulting from alternative splicing of STAU gene and encoding three isoforms have been described. Three of these variants encode the same isoform, however, differ in their 5'UTR.

Synonyms: Double stranded RNA binding protein Staufen homolog 1 antibody|Double stranded RNA binding protein Staufen homolog antibody|Double-stranded RNA-binding protein Staufen homolog 1 antibody|FLJ25010 antibody|MGC124588 antibody|STAU antibody|STAU1 antibody|STAU1_HUMAN antibody|staufen antibody|Staufen RNA binding protein (Drosophila) antibody|Staufen RNA binding protein homolog 1 antibody|Staufen, RNA binding protein, homolog 1 (Drosophila) antibody

Gene ID: 6780

UniProt: O95793

Pathways: Asymmetric Protein Localization