STIP1 antibody (C-Term)

Catalog No. ABIN3044551

Product Details anti-STIP1 Antibody

Target: STIP1 (Stress-Induced-phosphoprotein 1 (STIP1))

Binding Specificity: AA 505-543, C-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STIP1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Stress-induced-phosphoprotein 1(STIP1) detection. Tested with WB in Human,Rat.

Sequence: RLILEQMQKD PQALSEHLKN PVIAQKIQKL MDVGLIAIR

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Stress-induced-phosphoprotein 1(STIP1) detection. Tested with WB in Human,Rat.
Gene Name: stress induced phosphoprotein 1
Protein Name: Stress-induced-phosphoprotein 1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human STIP1 (505-543aa RLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for STIP1

Target: STIP1 (Stress-Induced-phosphoprotein 1 (STIP1))

Alternative Name: STIP1 (STIP1 Products)

Synonyms: HOP antibody, IEF-SSP-3521 antibody, P60 antibody, STI1 antibody, STI1L antibody, Hop antibody, Sti1 antibody, p60 antibody, MGC53256 antibody, stip1 antibody, MGC76181 antibody, MGC82554 antibody, zgc:92133 antibody, stress induced phosphoprotein 1 antibody, stress-induced phosphoprotein 1 antibody, stress induced phosphoprotein 1 L homeolog antibody, Stress-induced-phosphoprotein 1 antibody, stress-induced-phosphoprotein 1 antibody, stress induced phosphoprotein 1 S homeolog antibody, STIP1 antibody, Stip1 antibody, stip1.L antibody, GL50803_27310 antibody, PGTG_06468 antibody, stip1 antibody, stip1.S antibody

Background: STIP1 is an adaptor protein that coordinates the functions of HSP70 and HSP90 in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones. The International Radiation Hybrid Mapping Consortium mapped the STIP1 gene to 11q13.

Synonyms: Epididymis secretory sperm binding protein Li 94n antibody|HEL S 94n antibody|Hop antibody|Hsc70/Hsp90 organizing protein antibody| Hsc70/Hsp90-organizing protein antibody|IEF SSP 3521 antibody|NY REN 11 antigen antibody|P60 antibody|Renal carcinoma antigen NY-REN-11 antibody|STI1 antibody|STI1L antibody|STIP1 antibody|STIP1_HUMAN antibody|Stress induced phosphoprotein 1 antibody|Stress-induced-phosphoprotein 1 antibody|Transformation sensitive protein IEF SSP 3521 antibody|Transformation-sensitive protein IEF SSP 3521 antibody

Gene ID: 10963

UniProt: P31948