Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 6 (PSMD6) (N-Term) antibody

Details for Product No. ABIN309656
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms
Rpn7, S10, SGA-113M, p42A, p44S10, 2400006A19Rik, P44s10, zgc:56471, p44s10, rpn7, s10, 141231_at, CG5378, Dmel\\CG5378, S10a, anon-WO0172774.103, anon-WO0172774.106, DDBDRAFT_0190867, DDBDRAFT_023298 ... show more
Rpn7, S10, SGA-113M, p42A, p44S10, 2400006A19Rik, P44s10, zgc:56471, p44s10, rpn7, s10, 141231_at, CG5378, Dmel\\CG5378, S10a, anon-WO0172774.103, anon-WO0172774.106, DDBDRAFT_0190867, DDBDRAFT_0232985, DDB_0190867, DDB_0232985 show less
Epitope
N-Term
(5), (4), (3), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
(48), (36), (36), (26), (24), (14), (12), (2), (2)
Host
Rabbit
(43), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(30), (20), (16), (6), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN309656
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PSMD6
Sequence YEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEK NLGESEIRDA
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Chicken : 90 %, Rabbit : 90 %, African clawed frog : 80 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against PSMD6. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name PSMD6
Background PSMD6 acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.
Molecular Weight 45 kDa
Gene ID 9861
NCBI Accession NM_014814, NP_055629
UniProt Q15008
Research Area Proteolysis / Ubiquitin, Proteasome
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 389 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Bouwmeester, Bauch, Ruffner et al.: "A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway...." in: Nature cell biology, Vol. 6, Issue 2, pp. 97-105, 2004 (PubMed).

Hosts (43), (5)
Reactivities (48), (36), (36), (26), (24), (14), (12), (2), (2)
Applications (30), (20), (16), (6), (3), (1)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (5), (4), (3), (2), (2), (1)
back to top