Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309656

Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 6 (PSMD6) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
Rpn7, S10, SGA-113M, p42A, p44S10, 2400006A19Rik, P44s10, zgc:56471, p44s10, rpn7, s10, 141231_at, CG5378, Dmel\\CG5378, S10a, anon-WO0172774.103, anon-WO0172774.106, DDBDRAFT_0190867, DDBDRAFT_023298 ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309656
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PSMD6 antibody: synthetic peptide directed towards the N terminal of human PSMD6
Sequence YEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEK NLGESEIRDA
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Chicken : 92%, Rabbit : 92%, African clawed frog : 85%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against PSMD6. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name PSMD6
Background PSMD6 acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.
Molecular Weight 45kDa
Gene ID 9861
NCBI Accession NP_055629, NM_014814
UniProt Q15008
Research Area Proteolysis / Ubiquitin, Proteasome
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PSMD6 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Bouwmeester, Bauch, Ruffner et al.: "A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway." in: Nature cell biology, Vol. 6, Issue 2, pp. 97-105, 2004 (PubMed).

Alternatives for antigen "Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 6 (PSMD6)", type "Antibodies"
Hosts (40), (4)
Reactivities (44), (33), (33), (26), (24), (14), (12), (2), (2)
Applications (26), (20), (17), (6), (2), (1)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (4), (4), (2), (2), (2)
Beacon