Pyruvate Dehydrogenase Kinase, Isozyme 4 (PDK4) (N-Term) antibody

Details for Product No. ABIN309673
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AV005916
Epitope
N-Term
(12), (11), (5), (5), (5), (5), (4), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Dog (Canine), Human
(81), (33), (19)
Host
Rabbit
(74), (14)
Clonality
Polyclonal
Conjugate
Un-conjugated
(5), (4), (4), (4), (4), (4), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(75), (42), (26), (14), (10), (6), (2), (2), (1)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN309673
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PDK4
Sequence MKAARFVLRSAGSLNGAGLVPREVEHFSRYSPSPLSMKQL LDFGSENACE
Predicted Reactivity Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Bovine : 90 %, Guinea pig : 90 %, Mouse : 90 %, Rat : 90 %, Dog : 90 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against PDK4. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name PDK4
Background PDK4 is a member of the PDK/BCKDK protein kinase family and is a mitochondrial protein with a histidine kinase domain. This protein is located in the matrix of the mitrochondria and inhibits the pyruvate dehydrogenase complex by phosphorylating one of its subunits, thereby contributing to the regulation of glucose metabolism.This gene is a member of the PDK/BCKDK protein kinase family and encodes a mitochondrial protein with a histidine kinase domain. This protein is located in the matrix of the mitrochondria and inhibits the pyruvate dehydrogenase complex by phosphorylating one of its subunits, thereby contributing to the regulation of glucose metabolism. Expression of this gene is regulated by glucocorticoids, retinoic acid and insulin.
Molecular Weight 46 kDa
Gene ID 5166
NCBI Accession NP_002603, NM_002612
UniProt Q16654
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 411 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Pyruvate Dehydrogenase Kinase, Isozyme 4 (PDK4) (N-Term) antibody WB Suggested Anti-PDK4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T
anti-Pyruvate Dehydrogenase Kinase, Isozyme 4 (PDK4) (N-Term) antibody (2) Sample Type: Huh7 HepG2 (50ug)
Primary Antibody Dilution: 1:500
Image Submitted By: Partha Kasturi
University of Kansas Medical Center
anti-Pyruvate Dehydrogenase Kinase, Isozyme 4 (PDK4) (N-Term) antibody (3) anti-Pyruvate Dehydrogenase Kinase, Isozyme 4 (PDK4) (N-Term) antibody (Image 3)
anti-Pyruvate Dehydrogenase Kinase, Isozyme 4 (PDK4) (N-Term) antibody (4) WB Suggested Anti-PDK4
Antibody Titration: 0.2-1 µg/mL
Positive Control: Transfected 293T
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Validation Images
Did you look for something else?
back to top