You are viewing an incomplete version of our website. Please click to reload the website as full version.

PDK4 antibody (Pyruvate Dehydrogenase Kinase, Isozyme 4) (N-Term)

Details for Product anti-PDK4 Antibody No. ABIN309673, Supplier: Login to see New
New
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AV005916
Alternatives
Epitope
N-Term
(22), (22), (13), (12), (10), (7), (6), (6), (5), (5), (5), (4), (3), (3), (3), (3), (3), (3), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
(134), (61), (24)
Host
Rabbit
(138), (19)
Clonality
Polyclonal
Conjugate
This PDK4 antibody is un-conjugated
(10), (9), (7), (7), (7), (7), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(127), (82), (56), (21), (11), (11), (5), (4), (4), (1)
Pubmed 2 references available
Supplier Login to see New
Catalog number from supplier Login to see New
Quantity 50 μg
Options
Shipping to United States ( )
Availability Will be delivered in 2 to 3 Business Days
Immunogen Synthetic peptide directed towards the N terminal of human PDK4
Blocking Peptide Blocking peptide for this product available: ABIN981542
Sequence MKAARFVLRSAGSLNGAGLVPREVEHFSRYSPSPLSMKQL LDFGSENACE
Predicted Reactivity Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Bovine : 90 %, Guinea pig : 90 %, Mouse : 90 %, Rat : 90 %, Dog : 90 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against PDK4. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name PDK4 (PDK4 Antibody Abstract)
Background PDK4 is a member of the PDK/BCKDK protein kinase family and is a mitochondrial protein with a histidine kinase domain. This protein is located in the matrix of the mitrochondria and inhibits the pyruvate dehydrogenase complex by phosphorylating one of its subunits, thereby contributing to the regulation of glucose metabolism.This gene is a member of the PDK/BCKDK protein kinase family and encodes a mitochondrial protein with a histidine kinase domain. This protein is located in the matrix of the mitrochondria and inhibits the pyruvate dehydrogenase complex by phosphorylating one of its subunits, thereby contributing to the regulation of glucose metabolism. Expression of this gene is regulated by glucocorticoids, retinoic acid and insulin.
Molecular Weight 46 kDa
Gene ID 5166
NCBI Accession NP_002603, NM_002612
UniProt Q16654
Research Area Signaling, Metabolism
Pathways PI3K-Akt Signaling, Hedgehog Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 411 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
Western Blotting (WB) image for anti-PDK4 antibody (Pyruvate Dehydrogenase Kinase, Isozyme 4) (N-Term) (ABIN309673) WB Suggested Anti-PDK4 Antibody Titration: 0.2-1 ug/ml
Positive Control:...
Western Blotting (WB) image for anti-PDK4 antibody (Pyruvate Dehydrogenase Kinase, Isozyme 4) (N-Term) (ABIN309673) Sample Type: Huh7 HepG2 (50ug)
Primary Antibody Dilution: 1:500
...
Immunohistochemistry (IHC) image for anti-PDK4 antibody (Pyruvate Dehydrogenase Kinase, Isozyme 4) (N-Term) (ABIN309673) anti-Pyruvate Dehydrogenase Kinase, Isozyme 4 (PDK4) (N-Term) antibody (Image 3)
Western Blotting (WB) image for anti-PDK4 antibody (Pyruvate Dehydrogenase Kinase, Isozyme 4) (N-Term) (ABIN309673) WB Suggested Anti-PDK4
Antibody Titration: 0.2-1 µg/mL
Positive Control...
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. ..." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Catalog No. ABIN309673
$289.00
Plus shipping costs $45.00

Order hotline:

  • +1 877 302 8632
  • +1 888 205 9894 (TF)