Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309673

Pyruvate Dehydrogenase Kinase, Isozyme 4 (PDK4) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AV005916, 3j828, MGC52849, MGC132353
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 2 references available
Catalog no. ABIN309673
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PDK4 antibody: synthetic peptide directed towards the N terminal of human PDK4
Sequence MKAARFVLRSAGSLNGAGLVPREVEHFSRYSPSPLSMKQL LDFGSENACE
Predicted Reactivity Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Bovine : 92%, Guinea pig : 92%, Mouse : 92%, Rat : 92%, Dog : 91%, Chicken : 81%
Characteristics This is a rabbit polyclonal antibody against PDK4. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name PDK4
Background PDK4 is a member of the PDK/BCKDK protein kinase family and is a mitochondrial protein with a histidine kinase domain. This protein is located in the matrix of the mitrochondria and inhibits the pyruvate dehydrogenase complex by phosphorylating one of its subunits, thereby contributing to the regulation of glucose metabolism.This gene is a member of the PDK/BCKDK protein kinase family and encodes a mitochondrial protein with a histidine kinase domain. This protein is located in the matrix of the mitrochondria and inhibits the pyruvate dehydrogenase complex by phosphorylating one of its subunits, thereby contributing to the regulation of glucose metabolism. Expression of this gene is regulated by glucocorticoids, retinoic acid and insulin.
Molecular Weight 46kDa
Gene ID 5166
NCBI Accession NP_002603, NM_002612
UniProt Q16654
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PDK4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Alternatives for antigen "Pyruvate Dehydrogenase Kinase, Isozyme 4 (PDK4)", type "Antibodies"
Hosts (66), (7)
Reactivities (66), (25), (18), (5)
Applications (61), (25), (15), (12), (10), (7), (2), (2), (1)
Conjugates (5), (5), (4), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (7), (5), (5), (4), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon