Did you know that you can buy products from over 140 different suppliers from us?

PIK3R3 (Middle Region) antibody

Details for Product No. ABIN309699
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms p55pik, AA414954, pik3r3, zgc:55564, zgc:85710, p55, p55-GAMMA
Epitope
Middle Region
(9), (7), (2), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
(26), (5), (3), (3), (1), (1)
Host
Rabbit
(24), (8), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(31), (13), (8), (4), (3), (2), (2), (1), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN309699
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PIK3R3
Sequence EYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY IERFRREGNE
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against PIK3R3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Background PIK3R3 binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During insulin stimulation, it also binds to IRS-1.
Molecular Weight 54 kDa
Gene ID 8503
NCBI Accession NM_003629, NP_003620
UniProt Q92569
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 461 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Kallin, Johannessen, Cani et al.: "SREBP-1 regulates the expression of heme oxygenase 1 and the phosphatidylinositol-3 kinase regulatory subunit p55 gamma." in: Journal of lipid research, Vol. 48, Issue 7, pp. 1628-36, 2007 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN309699
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top