Pirin (PIR) (C-Term) antibody

Details for Product No. ABIN309703
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2310042L19Rik, Pirnl, zgc:92778, xpir, ATPIRIN1, PRN1, pirin
Epitope
C-Term
(4), (3), (3)
Reactivity
Mouse (Murine), Dog (Canine), Rat (Rattus), Cow (Bovine), Human
(24), (4), (3), (1), (1), (1), (1)
Host
Rabbit
(10), (7), (7), (1)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(22), (8), (4), (4), (3), (3), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN309703
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human PIR
Sequence SHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAK NGFERAKTWK
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against PIR. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name PIR
Background PIR is a member of the cupin superfamily. The protein is an Fe(II)-containing nuclear protein expressed in all tissues of the body and concentrated within dot-like subnuclear structures. Interactions with nuclear factor I/CCAAT box transcription factor as well as B cell lymphoma 3-encoded oncoprotein suggest the protein may act as a transcriptional cofactor and be involved in the regulation of DNA transcription and replication.This gene encodes a member of the cupin superfamily. The encoded protein is an Fe(II)-containing nuclear protein expressed in all tissues of the body and concentrated within dot-like subnuclear structures. Interactions with nuclear factor I/CCAAT box transcription factor as well as B cell lymphoma 3-encoded oncoprotein suggest the encoded protein may act as a transcriptional cofactor and be involved in the regulation of DNA transcription and replication. Alternatively spliced transcript variants have been described.
Molecular Weight 32 kDa
Gene ID 8544
NCBI Accession NM_003662, NP_003653
UniProt O00625
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 290 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Pirin (PIR) (C-Term) antibody WB Suggested Anti-PIR Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
anti-Pirin (PIR) (C-Term) antibody (2) anti-Pirin (PIR) (C-Term) antibody (Image 2)
Background publications Adams, Jia: "Structural and biochemical analysis reveal pirins to possess quercetinase activity." in: The Journal of biological chemistry, Vol. 280, Issue 31, pp. 28675-82, 2005 (PubMed).

Hosts (10), (7), (7), (1)
Reactivities (24), (4), (3), (1), (1), (1), (1)
Applications (22), (8), (4), (4), (3), (3), (2), (1), (1)
Epitopes (4), (3), (3)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top