Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309703

Pirin (PIR) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2310042L19Rik, Pirnl, zgc:92778, xpir, ATPIRIN1, PRN1, pirin
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN309703
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PIR antibody: synthetic peptide directed towards the C terminal of human PIR
Sequence SHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAK NGFERAKTWK
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against PIR. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name PIR
Background PIR is a member of the cupin superfamily. The protein is an Fe(II)-containing nuclear protein expressed in all tissues of the body and concentrated within dot-like subnuclear structures. Interactions with nuclear factor I/CCAAT box transcription factor as well as B cell lymphoma 3-encoded oncoprotein suggest the protein may act as a transcriptional cofactor and be involved in the regulation of DNA transcription and replication.This gene encodes a member of the cupin superfamily. The encoded protein is an Fe(II)-containing nuclear protein expressed in all tissues of the body and concentrated within dot-like subnuclear structures. Interactions with nuclear factor I/CCAAT box transcription factor as well as B cell lymphoma 3-encoded oncoprotein suggest the encoded protein may act as a transcriptional cofactor and be involved in the regulation of DNA transcription and replication. Alternatively spliced transcript variants have been described.
Molecular Weight 32kDa
Gene ID 8544
NCBI Accession NP_003653, NM_003662
UniProt O00625
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PIR antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Adams, Jia: "Structural and biochemical analysis reveal pirins to possess quercetinase activity." in: The Journal of biological chemistry, Vol. 280, Issue 31, pp. 28675-82, 2005 (PubMed).

Alternatives for antigen "Pirin (PIR)", type "Antibodies"
Hosts (10), (8), (7), (1)
Reactivities (25), (4), (3), (1), (1), (1), (1)
Applications (24), (9), (4), (4), (3), (3), (2), (1), (1)
Epitopes (4), (3), (3)
Beacon