Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6) antibody

Antigen: Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6)

Synonyms: MGC131971, 1700119G14Rik, 2310028P13Rik, 3110038K10Rik, C030013N01Rik, RGD1310937, PARP6, MGC166370, DKFZp459B2362

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN309724

Additional Information

Alternative name: PARP6

Gene ID: PARP6

Immunogen: The immunogen for anti-PARP6 antibody: synthetic peptide directed towards the C terminal of human PARP6

Sequence: KLPLSRLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTF AFHGSHIENW

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PARP6 antibody concentration is 1 mg/ml.

Description: Poly(ADP-ribose) polymerases (PARPs) constitute a large family of 18 proteins, encoded by different genes and displaying a conserved catalytic domain. They are involved in DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells.

Characteristics: Antigen Size: 519 amino acids

Molecular Weight: 59kDa

Application Details

Application Notes: WB Suggested Anti-PARP6 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-PARP6 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

anti-Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6) antibody (Image 2)

Publications

Product: Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).