Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309728

Recombination Signal Binding Protein For Immunoglobulin kappa J Region-Like (RBPJL) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RBPSUHL, SUHL, Rbpsuhl, rbpsuhl, RBP-L, RBPJL
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309728
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RBPJL antibody: synthetic peptide directed towards the N terminal of human RBPJL
Sequence AHQAGETGPTVCGYMGLDSASGSATETQKLNFEQQPDSRE FGCAKTLYIS
Predicted Reactivity Human : 100%, Bovine : 85%, Dog : 85%, Guinea pig : 85%, Horse : 85%, Mouse : 85%, Pig : 85%, Rat : 85%
Characteristics This is a rabbit polyclonal antibody against RBPJL. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name RBPJL
Background In mouse, recombining binding protein L (RBP-L) is a transcription factor that binds to DNA sequences almost identical to that bound by the Notch receptor signalling pathway transcription factor RBP-J. However, unlike RBP-J, RBP-L does not interact with Notch receptors. RBP-L has been shown to activate transcription in concert with Epstein-Barr virus nuclear antigen-2 (EBNA2). RBPSUHL is similar in sequence to the mouse RPB-L protein and Drosophila suppressor of hairless protein.In mouse, recombining binding protein L (RBP-L) is a transcription factor that binds to DNA sequences almost identical to that bound by the Notch receptor signalling pathway transcription factor RBP-J. However, unlike RBP-J, RBP-L does not interact with Notch receptors. RBP-L has been shown to activate transcription in concert with Epstein-Barr virus nuclear antigen-2 (EBNA2). The protein encoded by this gene is similar in sequence to the mouse RPB-L protein and Drosophila suppressor of hairless protein.
Molecular Weight 57kDa
Gene ID 11317
NCBI Accession NP_055091, NM_014276
UniProt Q5QPV0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RBPJL antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Beres, Masui, Swift et al.: "PTF1 is an organ-specific and Notch-independent basic helix-loop-helix complex containing the mammalian Suppressor of Hairless (RBP-J) or its paralogue, RBP-L." in: Molecular and cellular biology, Vol. 26, Issue 1, pp. 117-30, 2005 (PubMed).

Alternatives for antigen "Recombination Signal Binding Protein For Immunoglobulin kappa J Region-Like (RBPJL)", type "Antibodies"
Hosts (8), (1)
Reactivities (9), (1), (1), (1), (1), (1), (1)
Applications (9), (3), (3), (2), (2), (2)
Epitopes (5), (2), (2), (2), (1), (1)
Beacon