TAF6 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 80kDa (TAF6) antibody

Antigen: TAF6 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 80kDa (TAF6)

Synonyms: TAF2E, TAFII70, TAFII80, TAFII85, MGC:8964, DKFZp781E21155

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Xenopus laevis

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN309749

Additional Information

Alternative name: TAF6

Gene ID: TAF6

UniProt: A4D2B3

Immunogen: The immunogen for anti-TAF6 antibody: synthetic peptide directed towards the N terminal of human TAF6

Sequence: LTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLK NVEPLYGFHA

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-TAF6 antibody concentration is 1 mg/ml.

Description: TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF6 is one of the smaller subunits of TFIID that binds weakly to TBP but strongly to TAF1,the largest subunit of TFIID. One of the isoforms has been shown to preclude binding of one of the other TFIID subunits, thereby reducing transcription and initiating signals that trigger apoptosis.Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the smaller subunits of TFIID that binds weakly to TBP but strongly to TAF1, the largest subunit of TFIID. Four isoforms have been identified but complete transcripts have been determined for only three isoforms. One of the isoforms has been shown to preclude binding of one of the other TFIID subunits, thereby reducing transcription and initiating signals that trigger apoptosis.

Characteristics: Antigen Size: 667 amino acids

Molecular Weight: 71kDa

Application Details

Application Notes: WB Suggested Anti-TAF6 Antibody Titration: 1.25ug/ml
Positive Control: Transfected 293T.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-TAF6 Antibody Titration: 1.25ug/ml
Positive Control: Transfected 293T

anti-TAF6 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 80kDa (TAF6) antibody (Image 2)

Publications

Product: Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).