Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309784

Zinc Finger Protein 45 (ZNF45) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms KOX5, ZNF13, ZNF235
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309784
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF45 antibody: synthetic peptide directed towards the N terminal of human ZNF45
Sequence FCSQIWQQITRELIKYQDSVVNIQRTGCQLEKRDDLHYKD EGFSNQSSHL
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF45. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF45
Background ZNF45 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 18 C2H2-type zinc fingers and 1 KRAB domain. ZNF45 may be involved in transcriptional regulation.
Molecular Weight 78kDa
Gene ID 7596
NCBI Accession NP_003416, NM_003425
UniProt Q02386
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF45 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).

Alternatives for antigen "Zinc Finger Protein 45 (ZNF45)", type "Antibodies"
Hosts (5)
Reactivities (5), (1)
Applications (5), (2)
Epitopes (1), (1), (1)
Beacon