Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309791

Polymerase (RNA) II (DNA Directed) Polypeptide I, 14.5kDa (POLR2I) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RPB9, hRPB14.5, RPB14.5, 2810002B19Rik, zgc:103515, GB18029
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Dog (Canine), Zebrafish (Danio rerio), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309791
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-POLR2I antibody: synthetic peptide directed towards the N terminal of human POLR2I
Sequence ACRNCDYQQEADNSCIYVNKITHEVDELTQIIADVSQDPT LPRTEDHPCQ
Predicted Reactivity Bovine : 100%, Dog : 100%, Mouse : 100%, Rat : 100%, Zebrafish : 92%, African clawed frog : 85%
Characteristics This is a rabbit polyclonal antibody against POLR2I. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name POLR2I
Background POLR2I is a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit, in combination with two other polymerase subunits, forms the DNA binding domain of the polymerase, a groove in which the DNA template is transcribed into RNA. POLR2I has two zinc finger motifs with conserved cysteines and the subunit does possess zinc binding activity. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit, in combination with two other polymerase subunits, forms the DNA binding domain of the polymerase, a groove in which the DNA template is transcribed into RNA. The product of this gene has two zinc finger motifs with conserved cysteines and the subunit does possess zinc binding activity.
Molecular Weight 14kDa
Gene ID 5438
NCBI Accession NP_006224, NM_006233
UniProt P36954
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-POLR2I antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).

Alternatives for antigen "Polymerase (RNA) II (DNA Directed) Polypeptide I, 14.5kDa (POLR2I)", type "Antibodies"
Hosts (8), (6)
Reactivities (14), (3), (3), (1), (1), (1), (1), (1)
Applications (12), (8), (3), (2), (2)
Epitopes (3), (3)
Beacon