Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309796

Zinc Finger Protein 432 (ZNF432) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309796
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF432 antibody: synthetic peptide directed towards the N terminal of human ZNF432
Sequence GKSFLHGNYEELYSAAKFSVSTKANSTKSQVSKHQRTHEI EKNHVCSECG
Predicted Reactivity Horse : 91%
Characteristics This is a rabbit polyclonal antibody against ZNF432. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF432
Background ZNF432 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 16 C2H2-type zinc fingers and 1 KRAB domain. ZNF432 may be involved in transcriptional regulation.
Molecular Weight 75kDa
Gene ID 9668
NCBI Accession NP_055465, NM_014650
UniProt O94892
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF432 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Zhan, Desiderio: "Nitroproteins from a human pituitary adenoma tissue discovered with a nitrotyrosine affinity column and tandem mass spectrometry." in: Analytical biochemistry, Vol. 354, Issue 2, pp. 279-89, 2006 (PubMed).

Alternatives for antigen "Zinc Finger Protein 432 (ZNF432)", type "Antibodies"
Hosts (6)
Reactivities (6), (1), (1), (1), (1)
Applications (5), (3), (1)
Epitopes (3), (2), (1)
Beacon