Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309804

Ceramide Synthase 4 (CERS4) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2900019C14Rik, Lass4, Trh1, LASS4, trh1
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Pig (Porcine), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN309804
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-LASS4 antibody: synthetic peptide directed towards the C terminal of human LASS4
Sequence MLYSFMKKGQMEKDIRSDVEESDSSEEAAAAQEPLQLKNG AAGGPRPAPT
Predicted Reactivity Pig : 100%
Characteristics This is a rabbit polyclonal antibody against LASS4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name LASS4
Background LASS4 is a member of LASS family. Members of this family regulate (dihydro)ceramide synthases responsible for production of sphingolipids containing different fatty acids.
Molecular Weight 46kDa
Gene ID 79603
NCBI Accession NP_078828, NM_024552
UniProt Q9HA82
Research Area Cancer, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-LASS4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Background publications Gunnarsdóttir, Li, Bauchet et al.: "High-throughput sequencing of complete human mtDNA genomes from the Philippines." in: Genome research, Vol. 21, Issue 1, pp. 1-11, 2011 (PubMed).

Alternatives for antigen "Ceramide Synthase 4 (CERS4)", type "Antibodies"
Hosts (29), (8)
Reactivities (36), (14), (14), (13), (13), (12), (12)
Applications (27), (17), (10), (6), (4), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (4), (1), (1)
Beacon