Did you know that you can buy products from over 140 different suppliers from us?

Ceramide Synthase 4 (CERS4) (C-Term) antibody

Details for Product No. ABIN309804
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2900019C14Rik, Lass4, Trh1, LASS4, trh1
Epitope
C-Term
(6), (6), (4), (2), (1), (1), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Pig (Porcine), Dog (Canine), Cow (Bovine), Human
(47), (14), (14), (13), (13), (12), (12)
Host
Rabbit
(34), (14)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(38), (22), (10), (10), (4), (2)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN309804
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human LASS4
Sequence MLYSFMKKGQMEKDIRSDVEESDSSEEAAAAQEPLQLKNG AAGGPRPAPT
Predicted Reactivity Pig : 100 %
Characteristics This is a rabbit polyclonal antibody against LASS4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name LASS4
Background LASS4 is a member of LASS family. Members of this family regulate (dihydro)ceramide synthases responsible for production of sphingolipids containing different fatty acids.
Molecular Weight 46 kDa
Gene ID 79603
NCBI Accession NM_024552, NP_078828
UniProt Q9HA82
Research Area Cancer, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 394 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ceramide Synthase 4 (CERS4) (C-Term) antibody WB Suggested Anti-LASS4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Product cited in: Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Background publications Gunnarsdóttir, Li, Bauchet et al.: "High-throughput sequencing of complete human mtDNA genomes from the Philippines." in: Genome research, Vol. 21, Issue 1, pp. 1-11, 2011 (PubMed).

Hosts (34), (14)
Reactivities (47), (14), (14), (13), (13), (12), (12)
Applications (38), (22), (10), (10), (4), (2)
Conjugates (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (6), (4), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN309804
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top