Did you know that you can buy products from over 140 different suppliers from us?

Minichromosome Maintenance Complex Component 3 (MCM3) (C-Term) antibody

Details for Product No. ABIN309828
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HCC5, P1-MCM3, P1.h, RLFB, AL033361, C80350, Mcmd, P1, p1.m, CG4206, DmMCM3, DmMcm3, DmeMCM3, Dmel\\CG4206, MCM3, McM3, Mcp-PCR2, PCR2, dMCM3, cb32, chunp6867, wu:fa26g03
Epitope
C-Term
(9), (7), (7), (6), (4), (3), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
(69), (24), (21), (13), (13), (12), (1), (1)
Host
Rabbit
(47), (18), (9)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(63), (30), (14), (10), (10), (10), (8), (4), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN309828
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human MCM3
Sequence YAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRK RRKTRQPDAK
Predicted Reactivity Bovine : 100 %, Human : 100 %, Horse : 90 %, Mouse : 90 %, Rat : 90 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against MCM3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MCM3
Background MCM3 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression.The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression.The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression.
Molecular Weight 91 kDa
Gene ID 4172
NCBI Accession NM_002388, NP_002379
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 808 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Minichromosome Maintenance Complex Component 3 (MCM3) (C-Term) antibody WB Suggested Anti-MCM3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate
anti-Minichromosome Maintenance Complex Component 3 (MCM3) (C-Term) antibody (2) Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 5µg/ml using anti-MCM3 antibody (ARP36644_P050)
Background publications Lin, Aggarwal, Diehl: "Phosphorylation of MCM3 on Ser-112 regulates its incorporation into the MCM2-7 complex." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 105, Issue 23, pp. 8079-84, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN309828
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top