Zinc Finger and BTB Domain Containing 6 (ZBTB6) (N-Term) antibody

Details for Product No. ABIN309912
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms A830092L04Rik, ZID, Zfp482, Znf482, ZNF482
Epitope
N-Term
(7), (6), (5), (3), (3), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
(41), (22), (14), (2)
Host
Rabbit
(38), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(32), (21), (10), (5), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN309912
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZBTB6
Sequence MAAESDVLHFQFEQQGDVVLQKMNLLRQQNLFCDVSIYIN DTEFQGHKVI
Predicted Reactivity Bovine : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Chicken : 90 %
Characteristics This is a rabbit polyclonal antibody against ZBTB6. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZBTB6
Background ZBTB6 Contains 1 BTB (POZ) domain and 4 C2H2-type zinc fingers. It may be involved in transcriptional regulation.
Molecular Weight 48 kDa
Gene ID 10773
NCBI Accession NM_006626, NP_006617
UniProt Q15916
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 424 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger and BTB Domain Containing 6 (ZBTB6) (N-Term) antibody WB Suggested Anti-ZBTB6 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Hosts (38), (4)
Reactivities (41), (22), (14), (2)
Applications (32), (21), (10), (5), (2), (2), (1)
Conjugates (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (6), (5), (3), (3), (2), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top