Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309912

Zinc Finger and BTB Domain Containing 6 (ZBTB6) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms A830092L04Rik, ZID, Zfp482, Znf482, ZNF482
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309912
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZBTB6 antibody: synthetic peptide directed towards the N terminal of human ZBTB6
Sequence MAAESDVLHFQFEQQGDVVLQKMNLLRQQNLFCDVSIYIN DTEFQGHKVI
Predicted Reactivity Bovine : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Chicken : 92%
Characteristics This is a rabbit polyclonal antibody against ZBTB6. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZBTB6
Background ZBTB6 Contains 1 BTB (POZ) domain and 4 C2H2-type zinc fingers. It may be involved in transcriptional regulation.
Molecular Weight 48kDa
Gene ID 10773
NCBI Accession NP_006617, NM_006626
UniProt Q15916
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZBTB6 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Alternatives for antigen "Zinc Finger and BTB Domain Containing 6 (ZBTB6)", type "Antibodies"
Hosts (32), (4)
Reactivities (35), (21), (14), (2)
Applications (26), (16), (10), (5), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (3), (2), (2), (2), (1), (1), (1)
Beacon