Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309916

SRY (Sex Determining Region Y)-Box 15 (SOX15) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SOX20, SOX26, SOX27
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN309916
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SOX15 antibody: synthetic peptide directed towards the middle region of human SOX15
Sequence ASGGPLWGPGYATTQPSRGFGYRPPSYSTAYLPGSYGSSH CKLEAPSPCS
Predicted Reactivity Bovine : 100%, Guinea pig : 100%, Human : 100%, Dog : 92%, Mouse : 92%, Rat : 85%
Characteristics This is a rabbit polyclonal antibody against SOX15. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name SOX15
Background SOX15 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The protein may act as a transcriptional regulator after forming a protein complex with other proteins.This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.
Molecular Weight 25kDa
Gene ID 6665
NCBI Accession NP_008873, NM_006942
UniProt O60248
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SOX15 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Schepers, Teasdale, Koopman: "Twenty pairs of sox: extent, homology, and nomenclature of the mouse and human sox transcription factor gene families." in: Developmental cell, Vol. 3, Issue 2, pp. 167-70, 2002 (PubMed).

Alternatives for antigen "SRY (Sex Determining Region Y)-Box 15 (SOX15)", type "Antibodies"
Hosts (9), (6), (5), (1)
Reactivities (20), (2), (2), (2)
Applications (20), (12), (3), (2), (1)
Epitopes (5), (4), (3), (2), (1), (1)
Beacon