SRY (Sex Determining Region Y)-Box 15 (SOX15) (Middle Region) antibody

Details for Product No. ABIN309916
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms SOX20, SOX26, SOX27
Epitope
Middle Region
(5), (4), (3), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(19), (2), (2), (2)
Host
Rabbit
(9), (5), (5), (1)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(19), (8), (3), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN309916
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human SOX15
Sequence ASGGPLWGPGYATTQPSRGFGYRPPSYSTAYLPGSYGSSH CKLEAPSPCS
Predicted Reactivity Bovine : 100 %, Guinea pig : 100 %, Human : 100 %, Dog : 90 %, Mouse : 90 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against SOX15. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name SOX15
Background SOX15 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The protein may act as a transcriptional regulator after forming a protein complex with other proteins.This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.
Molecular Weight 25 kDa
Gene ID 6665
NCBI Accession NM_006942, NP_008873
UniProt O60248
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 233 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-SRY (Sex Determining Region Y)-Box 15 (SOX15) (Middle Region) antibody anti-SRY (Sex Determining Region Y)-Box 15 (SOX15) (Middle Region) antibody
Background publications Schepers, Teasdale, Koopman: "Twenty pairs of sox: extent, homology, and nomenclature of the mouse and human sox transcription factor gene families." in: Developmental cell, Vol. 3, Issue 2, pp. 167-70, 2002 (PubMed).

Hosts (9), (5), (5), (1)
Reactivities (19), (2), (2), (2)
Applications (19), (8), (3), (2), (1)
Epitopes (5), (4), (3), (2), (1), (1)
back to top