Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309938

GTF2I Repeat Domain Containing 1 (GTF2IRD1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
BEN, WBS, GTF3, RBAP2, CREAM1, MUSTRD1, WBSCR11, WBSCR12, hMusTRD1alpha1, 1700012P16Rik, Cream1, ESTM9, Gtf2il, MusTRD1, Tg(Alb1-Myc)166.8Sst, X83320, Gtf3, XBEN, XWBSCR11, cream1, gtf3, mustrd1, rbap ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN309938
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GTF2IRD1 antibody: synthetic peptide directed towards the N terminal of human GTF2IRD1
Sequence MALLGKRCDVPTNGCGPDRWNSAFTRKDEIITSLVSALDS MCSALSKLNA
Predicted Reactivity Dog : 100%, Human : 100%, Bovine : 92%, Horse : 92%, Rabbit : 85%, Guinea pig : 78%
Characteristics This is a rabbit polyclonal antibody against GTF2IRD1. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name GTF2IRD1
Background GTF2IRD1 contains five GTF2I-like repeats and each repeat possesses a potential helix-loop-helix (HLH) motif. It may have the ability to interact with other HLH-proteins and function as a transcription factor or as a positive transcriptional regulator under the control of Retinoblastoma protein. GTF2IRD1 is related to Williams-Beuren syndrome, a multisystem developmental disorder. Western blots using three different antibodies against three unique regions of this protein target confirm the same apparent molecular weight in our tests. The protein encoded by this gene contains five GTF2I-like repeats and each repeat possesses a potential helix-loop-helix (HLH) motif. It may have the ability to interact with other HLH-proteins and function as a transcription factor or as a positive transcriptional regulator under the control of Retinoblastoma protein. This gene is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by deletion of multiple genes at 7q11.23. Alternative splicing of this gene generates at least 2 transcript variants.
Molecular Weight 106kDa
Gene ID 9569
NCBI Accession NP_057412, NM_016328
UniProt Q9UHL9
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GTF2IRD1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Tassabehji, Hammond, Karmiloff-Smith et al.: "GTF2IRD1 in craniofacial development of humans and mice." in: Science (New York, N.Y.), Vol. 310, Issue 5751, pp. 1184-7, 2005 (PubMed).

Alternatives for antigen "GTF2I Repeat Domain Containing 1 (GTF2IRD1)", type "Antibodies"
Hosts (20), (11), (5)
Reactivities (33), (10), (10), (4), (2), (2), (1)
Applications (30), (21), (9), (7), (4), (4), (1), (1)
Epitopes (5), (4), (4), (2), (2), (2), (1), (1)
Beacon